ORFeome > MGC76290 – XORFeome 2.0

MGC76290 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76290, mRNA (cDNA clone MGC:76290 IMAGE:5379494), complete cds
Gene Symbol: MGC76290
Gene ID: 394513
ORF gb_acc: MG132871
ORF ID: 10231

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061626

Library Location

Plate ID: GDExt11002
Well Location: D12

EST Sequences

Clone: MGC:76290 IMAGE:5379494
Trimmed Sequence: ATGGAATCAGAAGCAAAAGACGGGGAAGAGGAGAACCTACAGAGTGCATTTAAAAAGCTGCGAGTTGATGCTGAAGGGTGCACGGCGTCCCTTTGTGCTACTAATGGGAGCACTACAAGGACATCTGTTCGACCTTCTTTAGAAGACACCAAACCGAAAATATTGGGCTCGCTAAAAGAAAGCTGGCATGGATCATCTAGAAAAACCACAAGGGGAGCGGTGAGAACACCTCGCAGAAGACGTTCCAAATCCCCTGTCCTTCATCCTCCAAAGTTTACACACTGCAGTGCAAAAGCCTCGACTAGCTCCCAGCTAAAACACAAAACCCTATGCGATACCCAAGATGGGGGTGGCAGTGTAGGCGGCACAGCTACCAGTGATCCAGCCAGCACTGCTCTTGACGTTGGTGGGTACAGAAGATTTTATCTCGAGCCATCAGGAGCTTCTCCTTCGGAGACCTCTTCAGAGACCATAAAAAATGCTTCCATTTCATTGGCTTCTCCTGCAAGTCTGACGGCTAGTCAGCCCTCAGATTTTCAGTCTGTATCCATACTCGGCACTGCTGCAGAATGCACTTGCGATGAGAAGGAATGCCAGTGCAAGAACTGCTGGCAAAACATGGAAGTGTACTCTTTCTCTGGCTTAAGGGACATGCTGTCGGAGTGTGAGAAGACAGTTAAAGAGGACCACTCTCAGACTTTGCAAAACAGAACTCAGCCTTCGGCTAACGGCACTTCCGGATCCCCACGCTCTTGCTCAGAACAAGCGAGAGCATCAGTGGATGATGTAACTATAGAAGACCTTGCAGGATACATGGAATATTACTTGTATATTCCAAAGAAAATGTCCCACATGGCTGAAATGATGTACACTTGA
Full Trace Sequence: cgagcggggttgcagagtcaccgcgtagtgagtgttgttcggaggtgtttaacgtgtggcggttctgttgtcaagtgctcagttctgagtggagagagttcggatggttttttgtgagtctcctgatctccctactgccagcatagctcagtaatggaatcagaagcaaaagacggggaagaggagaacctacagagtgcatttaaaaagctgcgagttgatgctgaagggtgcacggcgtccctttgtgctactaatgggagcactacaaggacatctgttcgaccttctttagaagacaccaaaccgaaaatattgggctcgctaaaagaaagctggcatggatcatctagaaaaaccacaaggggagcggtgagaacacctcgcagaagacgttccaaatcccctgtccttcatcctccaaagtttacacactgcagtgcaaaagcctcgactagctcccagctaaaacacaaaaccctatgcgatacccaagatgggggtggcagtgtaggcggcacagctaccagtgatccagccagcactgctcttgacgttggtgggtacagaagattttatctcgagccatcaggagcttctccttcggagacctcttcagagaccataaaaaatgcttccatttcattggcttctcctgcaagtctgacggctagtcagccctcagattttcagtctgtatccatactcggcactgctgcagaatgcacttgcgatgagaaggaatgccagtgcaagaactgctggcaaaacatggaagtgtactctttctctggcttaagggacatgctgtcggagtgtgagaagacagttaaagaggaccactctcagactttgcaaaacagaactcagccttcggctaacggcacttccggatccccacgctcttgctcagaacaagcgagagcatcagtggatgatgtaactatagaagaccttgcaggatacatggaatattacttgtatattccaaagaaaatgtcccacatggctgaaatgatgtacacttgataggcctcaaaatcccttgcttgaaccaataggcgcgggtgccatctaaccgccgcgtcgctgcaggagcttccttggcctcgagcctcttgtctccatttgccattaaatgcaagagtgacagatttcctaatttaaataccagcatttttgtcgatttatatttatgtcaaaagaaacaaccctatccagatttggtgggggggttacctgcattgaaacactataaagaggaaagaaaaaagtataaataagttataagtaaatatggaaagaaaatgaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MESEAKDGEEENLQSAFKKLRVDAEGCTASLCATNGSTTRTSVRPSLEDTKPKILGSLKESWHGSSRKTTRGAVRTPRRRRSKSPVLHPPKFTHCSAKASTSSQLKHKTLCDTQDGGGSVGGTATSDPASTALDVGGYRRFYLEPSGASPSETSSETIKNASISLASPASLTASQPSDFQSVSILGTAAECTCDEKECQCKNCWQNMEVYSFSGLRDMLSECEKTVKEDHSQTLQNRTQPSANGTSGSPRSCSEQARASVDDVTIEDLAGYMEYYLYIPKKMSHMAEMMYT
Donor tissue: tailbud