ORFeome > MGC76308 – XORFeome 2.0

MGC76308 – XORFeome 2.0

General Information

Species: Xenopus tropicalis adaptor-related protein complex 1, sigma 1 subunit, mRNA (cDNA clone MGC:76308 IMAGE:5379780), complete cds
Gene Symbol: MGC76308
Gene ID: 394963
ORF gb_acc: MG132832
ORF ID: 10182

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064274

Library Location

Plate ID: GDExt11002
Well Location: D11

EST Sequences

Clone: MGC:76308 IMAGE:5379780
Trimmed Sequence: ATGAGATTTATGCTGCTTTTCAGCCGGCAAGGGAAGCTCCGGTTGCAGAAGTGGTATGTGGCCATCTCGGAGCGAGATAAGAAGAAGCTGGTTCGCGATCTCATGCAGACCGTGCTGAGCCGGAAACCCAAAATGTGCAGCTTCCTGGAATGGAAAGATTTCAAAGTTGTCTACAAAAGGTATGCCAGCCTGTATTTCTGCTGCGCCGTTGAAGATCAGGATAATGAGCTGCTGACCCTGGAACTCATACACAGATACGTGGAGCTTCTGGACAAATATTTTGGCAGCGTGTGCGAGCTGGACATCATATTTAATTTTGAGAAGGCTTATTTCATCCTGGACGAGTTCCTGATGGGAGGGGAAATACAGGACACGTCCAAGAAAAGCGTCTTGAAGGCAATCGAGCAGTCAGACATGCTGCAGGAGGAGGATGAGTCACCGCGCAGCGTTCTGGAGGAAATGGGACTGGCTTGA
Full Trace Sequence: caggaggccgggagcttgcggggaacagcgttgcgggaggtatgagatttatgctgcttttcagccggcaagggaagctccggttgcagaagtggtatgtggccatctcggagcgagataagaagaagctggttcgcgatctcatgcagaccgtgctgagccggaaacccaaaatgtgcagcttcctggaatggaaagatttcaaagttgtctacaaaaggtatgccagcctgtatttctgctgcgccgttgaagatcaggataatgagctgctgaccctggaactcatacacagatacgtggagcttctggacaaatattttggcagcgtgtgcgagctggacatcatatttaattttgagaaggcttatttcatcctggacgagttcctgatgggaggggaaatacaggacacgtccaagaaaagcgtcttgaaggcaatcgagcagtcagacatgctgcaggaggaggatgagtcaccgcgcagcgttctggaggaaatgggactggcttgaaacaccgagaccctcacattcatcccctccccattactgcgacattcccacccttccaatcgtttaaacaccttgacaccctaccccctcccatcccttctcaggcacacgttgaccactgccctttagaagtttgtataggtatgtgtgtcgccgcttgtcttaacgtgtgcgtgtttgtgccctcggcagtatgaaagcaatgcgaaaaagggaccaatagctcagccgcgccttccttccttgcgctcaagcacacacactctcacctctccattcctccagacctgacgtaattccatgtatgtatatccagctgcacagatgatcacacgctggtgaacttgtttgaacactcggtgacgggcacttgtgtttggtgccctttttcccccaatgctctgtgaccccctgcagagctcaggaaggagttgtatttttttttctttttttttttttaagggcagccccttccctgttaaacaactgacatgaggatcccccccacctctgcacgttctggaataaacataggtgctgctgtaaaaaaaaaaaaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRFMLLFSRQGKLRLQKWYVAISERDKKKLVRDLMQTVLSRKPKMCSFLEWKDFKVVYKRYASLYFCCAVEDQDNELLTLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGEIQDTSKKSVLKAIEQSDMLQEEDESPRSVLEEMGLA
Donor tissue: tadpole