ORFeome > MGC76321 – XORFeome 2.0

MGC76321 – XORFeome 2.0

General Information

Species: Xenopus tropicalis proteasome (prosome, macropain) subunit, alpha type 6, mRNA (cDNA clone MGC:76321 IMAGE:5380309), complete cds
Gene Symbol: MGC76321
Gene ID: 394718
ORF gb_acc: MG132895
ORF ID: 10259

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061438

Library Location

Plate ID: GDExt11003
Well Location: G04

EST Sequences

Clone: MGC:76321 IMAGE:5380309
Trimmed Sequence: ATGTCTCGGGGATCCAGCGCGGGGTTTGACAGGCACATTACCATCTTCTCACCCGAAGGGCGTCTCTATCAAGTCGAATATGCATTCAAGGCGATCAACCAGGGGGGTCTTACATCAGTGGCTGTCAGAGGAAAAGACTGTGCTGTTGTTGTTACCCAAAGAAAAGTCCCAGACAAGCTGTTGGACAGCAACACAGTAACCCATTTATTCCGGATTACTGAATCCATTGGCTGTGTAATGACCGGAATGACAGCTGACAGCAGGTCGCAGGTCCAGCGGGCACGTTATGAGGCTGCAAATTGGAAGTACAAATACGGCTATGAAATCCCAGTAGATATGCTTTGTAAAAGGATTGCGGATATTTCTCAAGTATACACACAGAATGCTGAAATGAGGCCCTTAGGATGTTGCATGATCCTAATTGGAGTGGATGAGGAGAATGGACCACAAGTCTTTAAATGTGATCCTGCAGGCTACTATTGTGGCTTTAAGGCTACCACAGCTGGAGTGAAGCAAACTGAGGCCACCAGCTTCCTAGAAAAGAAAGTAAAGAAGAAATTGGACTGGACTTATGAGCAGACTCTTGAGACAGCCATTTCTTGTCTCTCCACGGTACTGTCTATTGATTTCAAACCTTCAGAACTGGAGGTGGGAGTCGTCACAGTCGAGGATCCAAAATTCAGAGTTCTTACAGAAGCAGAGATTGATGTCCACCTTGTTGCACTAGCTGAGCGTGACTAG
Full Trace Sequence: gccgcatctttgtcttagtcatgtctcggggatccagcgcggggtttgacaggcacattaccatcttctcacccgaagggcgtctctatcaagtcgaatatgcattcaaggcgatcaaccaggggggtcttacatcagtggctgtcagaggaaaagactgtgctgttgttgttacccaaagaaaagtcccagacaagctgttggacagcaacacagtaacccatttattccggattactgaatccattggctgtgtaatgaccggaatgacagctgacagcaggtcgcaggtccagcgggcacgttatgaggctgcaaattggaagtacaaatacggctatgaaatcccagtagatatgctttgtaaaaggattgcggatatttctcaagtatacacacagaatgctgaaatgaggcccttaggatgttgcatgatcctaattggagtggatgaggagaatggaccacaagtctttaaatgtgatcctgcaggctactattgtggctttaaggctaccacagctggagtgaagcaaactgaggccaccagcttcctagaaaagaaagtaaagaagaaattggactggacttatgagcagactcttgagacagccatttcttgtctctccacggtactgtctattgatttcaaaccttcagaactggaggtgggagtcgtcacagtcgaggatccaaaattcagagttcttacagaagcagagattgatgtccaccttgttgcactagctgagcgtgactagtcatcctactttcacctctgcccagaaagctcttgcctggtaaaatcacctgtcttcataacactttttgttttgttctctacataaataaaacagatttttttctttttggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKLLDSNTVTHLFRITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLEKKVKKKLDWTYEQTLETAISCLSTVLSIDFKPSELEVGVVTVEDPKFRVLTEAEIDVHLVALAERD
Donor tissue: tadpole