ORFeome > MGC76336 – XORFeome 2.0

MGC76336 – XORFeome 2.0

General Information

Species: Xenopus tropicalis 60S ribosomal protein L35, mRNA (cDNA clone MGC:76336 IMAGE:5380801), complete cds
Gene Symbol: MGC76336
Gene ID: 394512
ORF gb_acc: MG132963
ORF ID: 10339

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059774

Library Location

Plate ID: GDExt11003
Well Location: A12

EST Sequences

Clone: MGC:76336 IMAGE:5380801
Trimmed Sequence: ATGGCAAAGATCAAGGCCCGAGACTTGCGTGGTAAGAAGAAGGAAGAGCTGCTGAAGCAGCTCGATGACCTCAAAGTAGAACTGTCACAGCTCAGAGTTGCTAAAGTGACAGGAGGTGCTGCTTCAAAGCTGTCTAAGATCCGAGTTGTGCGCAAGTCTATTGCCAGAGTTCTGACTGTGATCAACCAGACACAGAAGGAAAACCTGAGGAAATTTTACAAAGGCAAGAAATACAAGCCTTTGGATCTGAGGCCAAAGAAGACCAGGGCCCTTAGGCGCCGGCTAAACAAGCATGAAGAGGGTCTGAGGACAAAGAAACAGCAAAGGAAAGATCGTCTTTTCTCTGCACGCAAATTTGCTGTCAAGGCTTAA
Full Trace Sequence: gcgataatggcaaagatcaaggcccgagacttgcgtggtaagaagaaggaagagctgctgaagcagctcgatgacctcaaagtagaactgtcacagctcagagttgctaaagtgacaggaggtgctgcttcaaagctgtctaagatccgagttgtgcgcaagtctattgccagagttctgactgtgatcaaccagacacagaaggaaaacctgaggaaattttacaaaggcaagaaatacaagcctttggatctgaggccaaagaagaccagggcccttaggcgccggctaaacaagcatgaagagggtctgaggacaaagaaacagcaaaggaaagatcgtcttttctctgcacgcaaatttgctgtcaaggcttaagtttcatgttctaaataaaaaaaactgtttggattggctaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRALRRRLNKHEEGLRTKKQQRKDRLFSARKFAVKA
Donor tissue: tadpole