ORFeome > MGC79471 – XORFeome 2.0

MGC79471 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79471 protein, mRNA (cDNA clone MGC:79471 IMAGE:6976297), complete cds
Gene Symbol: MGC79471
Gene ID: 448487
ORF gb_acc: MG133566
ORF ID: 11099

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076647

Library Location

Plate ID: GDExt11011
Well Location: H02

EST Sequences

Clone: MGC:79471 IMAGE:6976297
Trimmed Sequence: ATGAAGGTCTCTTGCGAGGATATAAACGGCCCCCGAAGTTCCCTGAGCCGGGCCTGGAATCACATGTCGTGGCTGTACTATCAGTACCTTCTGGTGACAGCGCTCTATATGTTGGAGCCCTGGGAGAGAACCATCTTCAATTCCATGCTGGTGTCAATAGTAGGAATGGCGTTATACACCGGCTATATCTTCATGCCCCAGCATATCCTGGCCATCTTGCACTACTTTGAGATTGTTCAATGA
Full Trace Sequence: cgcagatcggtagcagagcaccggggagggagtgtgtgagtccggcctgccgtgaatcccgggcactgagcgtgtcctgctgggatctctgtttctgctaattcccccgctgcgcctggaggatgaaggtctcttgcgaggatataaacggcccccgaagttccctgagccgggcctggaatcacatgtcgtggctgtactatcagtaccttctggtgacagcgctctatatgttggagccctgggagagaaccatcttcaattccatgctggtgtcaatagtaggaatggcgttatacaccggctatatcttcatgccccagcatatcctggccatcttgcactactttgagattgttcaatgacccagaagagccctgctttgcaagggcattgatggggggcacattggccatccctgtggtggcgtatctggcaccagcgtatacctagaagatggcaccatggatgtaggccacccgtcccaaggtgggatgaacagtatcacgtgtgagctgctggagcccttccatccctaacaggatgttcaacatgcaacgtcattcaaactggaacttgaccattttgttgccaaaaaaagcctgcagcttcctgtctgtgccgtagtcctatctgacagcaaaagggttaaaggcagtatttttctgtttgtaatagaattgttttaaatattgcacagtaaatgtattttatgaagtcaaaaaaaaaaaaaaa
Translation: MKVSCEDINGPRSSLSRAWNHMSWLYYQYLLVTALYMLEPWERTIFNSMLVSIVGMALYTGYIFMPQHILAILHYFEIVQ
Donor tissue: tailbud