ORFeome > MGC79502 – XORFeome 2.0

MGC79502 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79502 protein, mRNA (cDNA clone MGC:79502 IMAGE:6977052), complete cds
Gene Symbol: MGC79502
Gene ID: 493375
ORF gb_acc: MG133542
ORF ID: 11072

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080891

Library Location

Plate ID: GDExt11010
Well Location: E11

EST Sequences

Clone: MGC:79502 IMAGE:6977052
Trimmed Sequence: ATGGAAAGTAAAAGGATGGAAGAGCCGTATTTTACCTTTGGAATCATAGCAGATATTCAGTACGCTGATATGGATAATCGATTTAACTACCTAAAGACCAGTATGAGATATTACAGGAACAGCCTGACACAGCTTAAAGCCGCTGTTGAGGAGTGGGCTATGGAATCCATAAAACCGGCATTCATTCTTCAACTCGGAGATATCATCGATGGAATCAACACGAAGGATAAGAGTTCGAAAACCGCGCTTGAGAGGGTGTTAGTGGAAATGGACAAACTTCCCATCCAGTTCCATCACGTATGGGGCAACCATGAGTTCTACAACTTCAGCCGAGAATATTTAAATGGGTCCAAACTGAACTCCCAAGCTCGAGGGGACAGAATCGATCGGGGAGGGGGCACCTCCGAGAATGGAGAATTCAATGATGAATCGTTTTACGCCTATCATTTTAGTCCCTGCCCCAAATTTCGCTTTCTTTTAATCGATGGTTACGATCTTAGCCCCATTGGGAGGGAGAAGACGAGCCCCAAGTATGACATTGCCTTAAATCTACTCAAGGAAAAGAACCCAAATGAGGATCTGAACAGCCCAACAGGACTGGAGGAGGTGCAGTTCGTATTGTTCAATGGCGGCATCAGCCCATCCCAGCTGGATTGGATGGAAAGGGTTTTAACGTCTTCGGATGAGAAGGAAGAAAACGTTTTTGTTGTTAGCCACCTCCCAGTGCACCCAGATGCAGCCGACCCCATGTGCCTGGTTTGGAATTACCCCGAGGTCCTGTCCGTGCTGCAGTCCCATCCCTGTGTGGTGGGATACCTGGCTGGCCATAACCACGAAGGCAGATACTGCATGGACCCTTATGGAATTCACCACCTCACATTCAGCGGAGTCATTGAGACACCCCCAGAGAGCCGGGCCTTTGGGACAATGTATGTGTATGAGGATAAAATGGTTCTGAAAGGAAGAGGCCTTGTTGAAGACAGAACTTTATACTACAGAGACCCCAAGAATAAAGCAGAGAGACATTAA
Full Trace Sequence: ctcaggggcagactgatacaggacctgtgcccatgggcatgctggcagggggaagaaacttcaaaggaccatggaaagtaaaaggatggaagagccgtattttacctttggaatcatagcagatattcagtacgctgatatggataatcgatttaactacctaaagaccagtatgagatattacaggaacagcctgacacagcttaaagccgctgttgaggagtgggctatggaatccataaaaccggcattcattcttcaactcggagatatcatcgatggaatcaacacgaaggataagagttcgaaaaccgcgcttgagagggtgttagtggaaatggacaaacttcccatccagttccatcacgtatggggcaaccatgagttctacaacttcagccgagaatatttaaatgggtccaaactgaactcccaagctcgaggggacagaatcgatcggggagggggcacctccgagaatggagaattcaatgatgaatcgttttacgcctatcattttagtccctgccccaaatttcgctttcttttaatcgatggttacgatcttagccccattgggagggagaagacgagccccaagtatgacattgccttaaatctactcaaggaaaagaacccaaatgaggatctgaacagcccaacaggactggaggaggtgcagttcgtattgttcaatggcggcatcagcccatcccagctggattggatggaaagggttttaacgtcttcggatgagaaggaagaaaacgtttttgttgttagccacctcccagtgcacccagatgcagccgaccccatgtgcctggtttggaattaccccgaggtcctgtccgtgctgcagtcccatccctgtgtggtgggatacctggctggccataaccacgaaggcagatactgcatggacccttatggaattcaccacctcacattcagcggagtcattgagacacccccagagagccgggcctttgggacaatgtatgtgtatgaggataaaatggttctgaaaggaagaggccttgttgaagacagaactttatactacagagaccccaagaataaagcagagagacattaaaggctacattgcccctgttcattctatccagagcagccaatcaacagttagctttcactggccttgtggattggctgctttgggtcactgatctagtgtagttaaaataaaaaaagcaggaatctgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MESKRMEEPYFTFGIIADIQYADMDNRFNYLKTSMRYYRNSLTQLKAAVEEWAMESIKPAFILQLGDIIDGINTKDKSSKTALERVLVEMDKLPIQFHHVWGNHEFYNFSREYLNGSKLNSQARGDRIDRGGGTSENGEFNDESFYAYHFSPCPKFRFLLIDGYDLSPIGREKTSPKYDIALNLLKEKNPNEDLNSPTGLEEVQFVLFNGGISPSQLDWMERVLTSSDEKEENVFVVSHLPVHPDAADPMCLVWNYPEVLSVLQSHPCVVGYLAGHNHEGRYCMDPYGIHHLTFSGVIETPPESRAFGTMYVYEDKMVLKGRGLVEDRTLYYRDPKNKAERH
Donor tissue: tailbud