ORFeome > MGC79547 – XORFeome 2.0

MGC79547 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79547 protein, mRNA (cDNA clone MGC:79547 IMAGE:6978255), complete cds
Gene Symbol: MGC79547
Gene ID: 493395
ORF gb_acc: MG133664
ORF ID: 11218

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080914

Library Location

Plate ID: GDExt11012
Well Location: E01

EST Sequences

Clone: MGC:79547 IMAGE:6978255
Trimmed Sequence: ATGCTGCTGTGTGGGTTTGGGCAAGTCTTCCTACTTCTTAACCTGTGCAGCATCTTGCACCGGGGGCAAGGCAGTGAGGAGGATGCTGAATATGTAACATGCGGTTCCGTGGTAAAGCTGCTTAACTCTCGGCACAACGTGCGATTGCATTCGCATGATGTGAAGTACGGCTCGGGTAGCGGTCAGCAGTCTGTCACTGGCGTGGAGGCCTCAGATGATGCTAACAGCTACTGGAGAATAAGGGGCAAGACAGATGCCGACTGCTCACGTGGGGAGCCCATCAAGTGTGGTCAAGCTGTCCGTCTTACCCATGTGAACACTGGAAAGAACTTGCACACGCATCACTTCCCTTCCCCTCTTTCTAACAACCAGGAGGTAAGTGCTTTTGGGGATAATGGAGAAGGCGATGATCTGGATGCATGGATGGTGCAGTGCAGTGACACACTCTGGGAACGCGAAGAGAGTGTTCGTTTCAAGCACATTGGCACAAATGTCTACTTAACAATTACTGGGGAACAGTATGGACACCCAATTCGAGGCCAGAGAGAAGTCCATGGTATAACTAATCCAAATGCTCACAACTACTGGAAGGTAATGGAGGGAGTGTTTCTCAAACAAAGCTCCCCACCAGGTGCGAACAAACATGACGAATTGTGA
Full Trace Sequence: ctcgattgaggtgccggggaagcaatgctgctgtgtgggtttgggcaagtcttcctacttcttaacctgtgcagcatcttgcaccgggggcaaggcagtgaggaggatgctgaatatgtaacatgcggttccgtggtaaagctgcttaactctcggcacaacgtgcgattgcattcgcatgatgtgaagtacggctcgggtagcggtcagcagtctgtcactggcgtggaggcctcagatgatgctaacagctactggagaataaggggcaagacagatgccgactgctcacgtggggagcccatcaagtgtggtcaagctgtccgtcttacccatgtgaacactggaaagaacttgcacacgcatcacttcccttcccctctttctaacaaccaggaggtaagtgcttttggggataatggagaaggcgatgatctggatgcatggatggtgcagtgcagtgacacactctgggaacgcgaagagagtgttcgtttcaagcacattggcacaaatgtctacttaacaattactggggaacagtatggacacccaattcgaggccagagagaagtccatggtataactaatccaaatgctcacaactactggaaggtaatggagggagtgtttctcaaacaaagctccccaccaggtgcgaacaaacatgacgaattgtgaagaacatcaaaacctgtaaagcccctcttactactggggctccatgtgctcctgggggctgatgtacttgaacacagtaaactcttctaggtagtaaaaataaacacagatctgcctttatgaatgataccagcagcgcttctaaactatgtggcactattctatgtcacttttctgtacagatttatttcttaaaagggatatagtttggttattgtgtgctttttttagatctatatttttaaaccattgtttgttgttctgtttcttttgaacttgatccaaactgtaattttttcagaatatatctgttaggtggaaaaggcataataataacattttcaatgcacttaatggttgtgaccagtgctccctttgggaagagactcaagatgaagaattatttttaccgtgtttctgacggaacagttcacagcaaccttcacatacctaccgttggaacatttaattggaaggtttctgcctgttacatctcagtggatctagatggaaactattaatagaattcaccaatttaacatttaaaaattcaaaggacccctttggcatacagaatacaaagcttcagttgtataatggttgaatttgtcttaagagaggtcgatgggccaaacctatggctcccagcatactcaaatttttttttgagaatatgatattgttgttttataataatcaggcccaccaaattagtaaaatagaataattggcccattgcaagcaaatcctggctagctatggcttggcctcttacatcactataaacccataacattacagattaataataatcatttaataatgatcattgtgttgcgaattaatgttttacaaaaataaaataaagcagattaaaacatctttacagactcagacttgtatagagtaataaccatcacatgggcttcttggctgttaacccctttgactcaagttcttgtcctgtgtaaaatatgttccatggttgttgatcaacttgtccattgatcttgataaccctaaaccagcacgaggaaattgagcatataaatatgacaaactggttgcacacacaatcctgaaaaacaatgtgggataagaaaaataaaaaaactatatgaactgtaaagtgttgtacagaattcaagctgaccacctgcctgtgcttttacaggctttgtgtgtgctgccagttctactagaacaaacaaatactgttaacagctgttcttggaatatcatgttattagtcctgagaatactttttgtttgctttttatgccgcacagactgaagctttgcagagttcatgttttacactgaacccaggtagatttgtcagaatgattaagccatgatgttacttgttgtactcaaatagaaaaaagagaaataaaaattgcactggtcagaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLLCGFGQVFLLLNLCSILHRGQGSEEDAEYVTCGSVVKLLNSRHNVRLHSHDVKYGSGSGQQSVTGVEASDDANSYWRIRGKTDADCSRGEPIKCGQAVRLTHVNTGKNLHTHHFPSPLSNNQEVSAFGDNGEGDDLDAWMVQCSDTLWEREESVRFKHIGTNVYLTITGEQYGHPIRGQREVHGITNPNAHNYWKVMEGVFLKQSSPPGANKHDEL
Donor tissue: tailbud