ORFeome > MGC79562 – XORFeome 2.0

MGC79562 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79562 protein, mRNA (cDNA clone MGC:79562 IMAGE:6978588), complete cds
Gene Symbol: MGC79562
Gene ID: 493282
ORF gb_acc: MG133614
ORF ID: 11154

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080334

Library Location

Plate ID: GDExt11011
Well Location: C09

EST Sequences

Clone: MGC:79562 IMAGE:6978588
Trimmed Sequence: ATGAAACTGTTCGTGTGCTGGATAATTAGCTACCTGCTCTGCCTGGCCGGGCTGAGGAAGATGTGGAGTGGCCGGTACCTGAGGAGTCACCTCAGCAGATCCCTGTACATGAATATGATGAGCCACAGCCAGGCCCCGTACTGGGATGGGAATCAGCAGTGGTACTTTTGCGACACAGAAAAATTAAGTGATTGCCTTCGGCCGGTTTTCATCCAGAGTTACTTAGACCATGGAACCCAGACATTCCTGAACAGAAGTATTGAGAAATCTGGCTGGCTTTCCATTCAGCTCTACCATTCCTTCATGTCCTCTGTGTTCAGTATGTTTATGTCCAGAACATCAATCAATGGGTTGCTTGGAAGAGGGTCAATGTTTGTGTTTTCACCAGAACAGTTCCAAAGGCTTCTCAAAATTGACCCCGAGTGGAAATCACATCGCTTGTTGGATTTAGGTGCAGGGGATGGGGAAGTGACTAAAGTAATGAGCCCTCATTTTGAAGAGATCTATGTTACAGAAATGTCTCAGACTATGATATGGCAACTTCAAAAGAAAAAGTACAGAGTGCTTAATATTGATGAATGGCAAAGCACAGGATTCCAGTATGACGTTATTAGCTGCTTAAACCTCCTTGATCGATGTCATCAGCCAGTGACATTACTGAAAGAGATGAGAAGTGTTTTGGAGCCAACTAGAGGGAGGGTAATACTGGCACTAGTATTGCCGTTTCATCCCTACGTAGAAAATGGTGGCAAATGGGAGAAGCCTTCAGAAGTCATGGAAGTGACCGGAACAGTTTGGGAGGAGCAGGTGAACAGCCTCGCCGATGTCTTCCATGTAGCAGGCTTTGCGGTGGAAGCCGTCACCCGACTCCCTTATTTATGCGAAGGAGACATGTACAATGACTACTACGTATTGGACGATGCCGTCTTTGTTCTTCGGCCAATATAG
Full Trace Sequence: ccacccctctcttgtattccactcctcaggctgatgtgtacatcccgctgggccatggcctgctccggtcccggacgaagtgagtgggcgctgctcagatgaaactgttcgtgtgctggataattagctacctgctctgcctggccgggctgaggaagatgtggagtggccggtacctgaggagtcacctcagcagatccctgtacatgaatatgatgagccacagccaggccccgtactgggatgggaatcagcagtggtacttttgcgacacagaaaaattaagtgattgccttcggccggttttcatccagagttacttagaccatggaacccagacattcctgaacagaagtattgagaaatctggctggctttccattcagctctaccattccttcatgtcctctgtgttcagtatgtttatgtccagaacatcaatcaatgggttgcttggaagagggtcaatgtttgtgttttcaccagaacagttccaaaggcttctcaaaattgaccccgagtggaaatcacatcgcttgttggatttaggtgcaggggatggggaagtgactaaagtaatgagccctcattttgaagagatctatgttacagaaatgtctcagactatgatatggcaacttcaaaagaaaaagtacagagtgcttaatattgatgaatggcaaagcacaggattccagtatgacgttattagctgcttaaacctccttgatcgatgtcatcagccagtgacattactgaaagagatgagaagtgttttggagccaactagagggagggtaatactggcactagtattgccgtttcatccctacgtagaaaatggtggcaaatgggagaagccttcagaagtcatggaagtgaccggaacagtttgggaggagcaggtgaacagcctcgccgatgtcttccatgtagcaggctttgcggtggaagccgtcacccgactcccttatttatgcgaaggagacatgtacaatgactactacgtattggacgatgccgtctttgttcttcggccaatatagaagagcaagagaatggtagaacgatgggagagcagttcatgctcttggactaagagccaccaaggaaaccattctctcagcaagtcaaattcaattcctcacaggccaaaattgtatgtatttcccgcaggacttggtttggatacataaatctatatgtgcgtgggtgtgtgtgagcgtgtttgtgtgaaatcttacccgggccgggggtggaggcagagttggggtgcttattctttttaaccaacagtgctacctttccaagcagcggagaattttaatgctgccaatgccatcgtgccgccagccggccctgtgacaaattgacacaggaacaggaacgagaaggacttttctgataaagtactgatcctggcaataaagtttgtcgtatttaatcaactgtgaaatatacgtgttcttccatgtgatttaatagtcttgtttgccattttgaagcacatccttttttttaccatggcaataaaaattgtatcaaatgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKLFVCWIISYLLCLAGLRKMWSGRYLRSHLSRSLYMNMMSHSQAPYWDGNQQWYFCDTEKLSDCLRPVFIQSYLDHGTQTFLNRSIEKSGWLSIQLYHSFMSSVFSMFMSRTSINGLLGRGSMFVFSPEQFQRLLKIDPEWKSHRLLDLGAGDGEVTKVMSPHFEEIYVTEMSQTMIWQLQKKKYRVLNIDEWQSTGFQYDVISCLNLLDRCHQPVTLLKEMRSVLEPTRGRVILALVLPFHPYVENGGKWEKPSEVMEVTGTVWEEQVNSLADVFHVAGFAVEAVTRLPYLCEGDMYNDYYVLDDAVFVLRPI
Donor tissue: tailbud