ORFeome > MGC79782 – XORFeome 2.0

MGC79782 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79782 protein, mRNA (cDNA clone MGC:79782 IMAGE:6985887), complete cds
Gene Symbol: MGC79782
Gene ID: 493246
ORF gb_acc:
ORF ID: 11341

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC079961

Library Location

Plate ID: GDExt11013
Well Location: D03

EST Sequences

Clone: MGC:79782 IMAGE:6985887
Trimmed Sequence: ATGTTCCTGAGATGTACTGGTGGGGAGGTGGGAGCCACTTCTGCTCTGGCCCCTAAAATCGGACCTTTGGGTTTGTCTCCCAAAAAAGTGGGGGATGACATTGCCAAGGCTACCGGTGACTGGAAGGGGCTGAGGATCACAGTCAAACTGACCATCCAGAACAGACAGGCCCAGATTGAGGTTGTGCCATCTGCCTCCGCCCTGATCATTAAAGCCCTGAAGGAGCCTCCCCGTGATAGGAAGAAGCAGAAGAACATTAAACACAACGGCAACATCTCCATGGACGAAGTGATCAGCATCGCCCGCCAGATGAGGCACCGATCCCTGGCCAGGGAGCTTTCCGGAACCATTAAGGAGATCCTGGGTACCGCACAGTCCGTAGGGTGCAACGTGGATGGGAGACACCCCCATGACATCATTGACGACATCAACAGCGGTGCAGTAGAGTGCCCGGCGAGCTAA
Full Trace Sequence: cgctggtagaggtgcaactacttatcggtcgtcccgaatctgggttcatccgacaccgaaaccggcccgagtgaagcggactgcccctagtattctgccgccatgcctcccaaattcgaccccaccgagattaaagtcggtacgtgtgtatttctgggcctgtcccacagccgagcccgcacgcctgagcccggccgccccagcaggccgcagccacggtacttgggatcctccggctgccttcccgtggggtaacgcttctaccggggcatgttcctgagatgtactggtggggaggtgggagccacttctgctctggcccctaaaatcggacctttgggtttgtctcccaaaaaagtgggggatgacattgccaaggctaccggtgactggaaggggctgaggatcacagtcaaactgaccatccagaacagacaggcccagattgaggttgtgccatctgcctccgccctgatcattaaagccctgaaggagcctccccgtgataggaagaagcagaagaacattaaacacaacggcaacatctccatggacgaagtgatcagcatcgcccgccagatgaggcaccgatccctggccagggagctttccggaaccattaaggagatcctgggtaccgcacagtccgtagggtgcaacgtggatgggagacacccccatgacatcattgacgacatcaacagcggtgcagtagagtgcccggcgagctaaacctgccccgggagccaatgggattcctcaataaagagagattaactgtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MFLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHNGNISMDEVISIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Donor tissue: tadpole