ORFeome > MGC79783 – XORFeome 2.0

MGC79783 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC79783 protein, mRNA (cDNA clone MGC:79783 IMAGE:6985890), complete cds
Gene Symbol: MGC79783
Gene ID: 448538
ORF gb_acc: MG133760
ORF ID: 11329

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076706

Library Location

Plate ID: GDExt11013
Well Location: C03

EST Sequences

Clone: MGC:79783 IMAGE:6985890
Trimmed Sequence: ATGGGTACTGAGGCCAAACCTGATATTTACTCTGTGGAGATCAGTGGAACAAGGGATGTAGAAAATCCAGACCAAGAAAATGAAAAAGAGAAGTACAAGGATCTCCACAAGAAAAAAAATAAGAAGGCAAAGAAAAAAGACAAGAAAGTAGATGAACTTAAGCAAGAACTTGATCTGGAAGATCATAAACTCAGTGTGGAAGAATTGGAAGCAAAATATAATACAAGTCTTCTCAAAGGTCTCACCAGTGCAAGAGCTGCAGAGGTTCTGGCTCGCGATGGTCCCAACGCACTTACACCCCCAAAGGGTACTCCTGAAATTGTCAAATTCATTAGGCAGATGATAGGAGGTTTCTCCCTGCTTTTGTGGGCTGGTGCTGTCCTCTGCTGGATTGCATACGCGATTCAGTATGCCTCAGACAATGCAGTCTCGAGAGATAATCTGTATCTAGGTGTTGTCCTTGCAGTGGTTGTCATACTCACTGGCTGCTTTGCCTATATCCAGGAGGCTAAAAGTACTAATATCATGGCCAGTTTCAAAAAAATGATTCCACAGCAAGCTATTGTTACCCGCAATGGAGAGTAA
Full Trace Sequence: gaaagctttcccgtcctgcctgaagatgtcaaggtgtggggaggattgcagctaacattggctccttgttgggacagccacagcctctacaagctcttgcatttgaaaaatctagtgtggacattcatcttctgatttgttttttgactctctgtttgatcctccttgttagagcaaggcgacagtcacctgttcttaataaaaacaaaagataaaatgggtactgaggccaaacctgatatttactctgtggagatcagtggaacaagggatgtagaaaatccagaccaagaaaatgaaaaagagaagtacaaggatctccacaagaaaaaaaataagaaggcaaagaaaaaagacaagaaagtagatgaacttaagcaagaacttgatctggaagatcataaactcagtgtggaagaattggaagcaaaatataatacaagtcttctcaaaggtctcaccagtgcaagagctgcagaggttctggctcgcgatggtcccaacgcacttacacccccaaagggtactcctgaaattgtcaaattcattaggcagatgataggaggtttctccctgcttttgtgggctggtgctgtcctctgctggattgcatacgcgattcagtatgcctcagacaatgcagtctcgagagataatctgtatctaggtgttgtccttgcagtggttgtcatactcactggctgctttgcctatatccaggaggctaaaagtactaatatcatggccagtttcaaaaaaatgattccacagcaagctattgttacccgcaatggagagtaaactttcacgaaaatttaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGTEAKPDIYSVEISGTRDVENPDQENEKEKYKDLHKKKNKKAKKKDKKVDELKQELDLEDHKLSVEELEAKYNTSLLKGLTSARAAEVLARDGPNALTPPKGTPEIVKFIRQMIGGFSLLLWAGAVLCWIAYAIQYASDNAVSRDNLYLGVVLAVVVILTGCFAYIQEAKSTNIMASFKKMIPQQAIVTRNGE
Donor tissue: tadpole