ORFeome > MGC88898 – XORFeome 2.0

MGC88898 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC88898 protein, mRNA (cDNA clone MGC:88898 IMAGE:6998706), complete cds
Gene Symbol: MGC88898
Gene ID: 493451
ORF gb_acc: MG134052
ORF ID: 11671

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC081287

Library Location

Plate ID: GDExt11016
Well Location: F07

EST Sequences

Clone: MGC:88898 IMAGE:6998706
Trimmed Sequence: ATGGCTTCTACAGAGTGTAAGCACTACCATGATGAAGAGTACGATCCTTGCCTTTTATTTGAAACCTACATTGGGGCTGATAAGGATCCTTCCAAGGATCAGATGATAGAATATCCCATTAAAGTTCTCCATGATATACTCTCTTCAGGATCAGTGAAAGGAGAAACTTTAATCGAACTTAGTGTTAGTTCATCATTTATACATATTCTGGTGGCTGCTGATTACTTTGACAACATCATTTCGCTCCAACCCTCCGAATCTGATTATCAAGAGGTACAGAAATGGTTAAACAAGGAACCAGGAGCCATAGACCACTCCCACCTTACAGAGTTTTTTTGTGGTCTTAAAGATGAATGCTCAGACTGTAAAGAACATGAAGAAAAGACCAGAAGAGCCATCAAACAGATTTTAAGATGGGATATTACCAAAGATAACCCACTGGGTGATGTTGTGTTGCCCCAAGCAGACTGTGTGTACAGTTGCGCCTACTTGGAACCTGTTAGTAAAGATCATGAGATGTATCTGAAGCTCCTAAAACAAATCTGCTCCCTTGTGAAGGTTGGAGGTCACCTGATCCTCATTTCAGTATTCAATATCTCTTACTTTATGTTAGGCCAACACAAGTTTTCCGCCCTGACATGTGATGAAGAGTTTGTGCGAAAGGCTGTGTCGAGCAACGGGTTAATTATAGAGAAATTTGAGAAAGAAAAAAACAAATACAATTCTGATTTGTTTGATTATGAATTTTTGGCATATTTTGTATGCCGGAAGGATAGAGAGGTCTAA
Full Trace Sequence: caaggagccacatctcgagcgaagagctgcctgcctcaaaaagaaaggtagattttgggcacaaatcgctcccacattgcttataatggcttctacagagtgtaagcactaccatgatgaagagtacgatccttgccttttatttgaaacctacattggggctgataaggatccttccaaggatcagatgatagaatatcccattaaagttctccatgatatactctcttcaggatcagtgaaaggagaaactttaatcgaacttagtgttagttcatcatttatacatattctggtggctgctgattactttgacaacatcatttcgctccaaccctccgaatctgattatcaagaggtacagaaatggttaaacaaggaaccaggagccatagaccactcccaccttacagagtttttttgtggtcttaaagatgaatgctcagactgtaaagaacatgaagaaaagaccagaagagccatcaaacagattttaagatgggatattaccaaagataacccactgggtgatgttgtgttgccccaagcagactgtgtgtacagttgcgcctacttggaacctgttagtaaagatcatgagatgtatctgaagctcctaaaacaaatctgctcccttgtgaaggttggaggtcacctgatcctcatttcagtattcaatatctcttactttatgttaggccaacacaagttttccgccctgacatgtgatgaagagtttgtgcgaaaggctgtgtcgagcaacgggttaattatagagaaatttgagaaagaaaaaaacaaatacaattctgatttgtttgattatgaatttttggcatattttgtatgccggaaggatagagaggtctaaatgcctgaatccctaaagacgaagttcatcttaacattgctattagttttttaggcttggtgattatggtttcatagttatggagaccttgctcctcacaacacaacatggtataaattcgaattaaacttgatcattgctgtttttataaaatgtcacaataatgcttgaattgtgcgtacgaataccgaatttttcgagttgaaagtattgttaagactcaaaaaattggagtttaaatggatgttcgtttccataaattctctttatttttcctaaacaggaagtgctccagcagccattttaggaccattggcactcattcttggaaaacaataatgtgtttaattttcacttgaaactgggtgaaatagaaaacaataatgagatgaacttccccatgaaactgggtgaaatagaaaacaaagacgggattaacttctccatgaaactgggtgaaacagaaaacaatgatgagattaacttccccatgaaactgggtgaaatagaaagcaatgaggggattaacttctccatgaaactgggtgaaatagaaaacaatgaggggattaacttccccatgaaactgggtgaaatagaaaacaatgaggggattaacttctccatgaaactgggtgaaacagaaaacaatgaggggattaacttccccatgaaactgggtgaaatagaaaacaatgaggggattaacttctccatgaaactgggtgaaatagaaagcaatgaggggattaacttctccatgaaactgggtgaaacagaaaacaatgaggggattaatttgtcattcagaatgtgtcaagcacaggctgtcactgactattctattcctttactagtctaaccctccataagactcaatggtactggacagatcgaacctttctatttccaaaaaaagttaaataaacattaataaatcacaaatgattggagttattttttaaaaactagaatttttcagggaacaataataaaaaaatgagttctggtgaaaacccattcataaatctcgaaattatctagaagtaagaaaaaaaatccaactttatctcaaaattgcttagtaaatgtgccccccaattccagccagggcaacttaaggatatagttggtaagtttcccactttctgcctggtgtttcttctagatttctcccatgttccaagactgagcctagtgtgaattccatagggtgctttaatcataagttccatggtgcagaaactgatgtgaatggtatataacaatatatttaataacacaatttaaagtagcttttcattggtaatgagaaatctcctgctaaattaataaaatattataatgacatttggaagtggttggattcattttggctgctgaaccattgttatcatcaattaaataaagataagtttatactttatctgcaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MASTECKHYHDEEYDPCLLFETYIGADKDPSKDQMIEYPIKVLHDILSSGSVKGETLIELSVSSSFIHILVAADYFDNIISLQPSESDYQEVQKWLNKEPGAIDHSHLTEFFCGLKDECSDCKEHEEKTRRAIKQILRWDITKDNPLGDVVLPQADCVYSCAYLEPVSKDHEMYLKLLKQICSLVKVGGHLILISVFNISYFMLGQHKFSALTCDEEFVRKAVSSNGLIIEKFEKEKNKYNSDLFDYEFLAYFVCRKDREV
Donor tissue: