ORFeome > MGC88939 – XORFeome 2.0

MGC88939 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC88939 protein, mRNA (cDNA clone MGC:88939 IMAGE:7002637), complete cds
Gene Symbol: MGC88939
Gene ID: 448551
ORF gb_acc: MG134038
ORF ID: 11653

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076883

Library Location

Plate ID: GDExt11016
Well Location: G02

EST Sequences

Clone: MGC:88939 IMAGE:7002637
Trimmed Sequence: ATGGGGACGAGCAATGGCAGCAAGAGCCTGACCCCGGGGCCGTCCCCGCCCGACCCCAGTCCCACTGCTCCGGGCTGCGGGAATGGGGCAATGATGGGCTCTTTCGGGATCTTCTTGCAAGGCCTGCTGGCTGTGATGGCTTTCAGCATCCTCATGTTAAAACGCCTTCGAGAACCAAAGCATGAAAGACGTCCTTGGAAAATATGGTTTTTGGACACATCCAAGCAAGCTATAGGGATGCTGTTTATCCATTTTGCAAACGTCTACTTGTCGGACCTTACCGGGGAAGATCCTTGCTCTATATATCTGATTAATTTCCTGCTGGACGCTACATTGGGAATGTTGCTCATTTATATCGGGGTTCGAGTAGTGAGTTGCATCGTGGAGTGGAGGCAGTGGGAGTCCTTGCGATTTGGCGAATATGGTGAACCTATGCAGTGCAAAGCCTGGGTTGGTCAGTGTGCTCTCTACATTGTCATCATGATGTTTGAGAAAGCAGCCATCATCCTTGTGCTGCTCATACCACATCTCAAAGAGGTTGCCAAGGTAAAACCTATAAAAAAACCCTCAGCTGGAACTTGCAACTGTCATGCTGATTGTCCCGTTCTTTGTTAA
Full Trace Sequence: cgctggttgcctcggtgaccggctctagagctggcccggggcccggtagcgggttctcctagccatggggacgagcaatggcagcaagagcctgaccccggggccgtccccgcccgaccccagtcccactgctccgggctgcgggaatggggcaatgatgggctctttcgggatcttcttgcaaggcctgctggctgtgatggctttcagcatcctcatgttaaaacgccttcgagaaccaaagcatgaaagacgtccttggaaaatatggtttttggacacatccaagcaagctatagggatgctgtttatccattttgcaaacgtctacttgtcggaccttaccggggaagatccttgctctatatatctgattaatttcctgctggacgctacattgggaatgttgctcatttatatcggggttcgagtagtgagttgcatcgtggagtggaggcagtgggagtccttgcgatttggcgaatatggtgaacctatgcagtgcaaagcctgggttggtcagtgtgctctctacattgtcatcatgatgtttgagaaagcagccatcatccttgtgctgctcataccacatctcaaagaggttgccaaggtaaaacctataaaaaaaccctcagctggaacttgcaactgtcatgctgattgtcccgttctttgttaatgcattaatgttttgggttgtggacaattttctaatgaagaaaggcaagacaaaagccaagacggaagaaagggagggcagccctgactctcggaatggcaccacagtccggtatcggcgtactgcttcatatgatgaatcagaatcagaaattctcatctcagcagatgatgaaatggaagagtcagagggggaggatgatttgcgcaggctcactaattccaagccggttaagaaaaagaagcatcgctttggccttcctgtatgacgtggtttctcgggagaacaaaggctccagtaagctgaggcctgcaagaggaatagcgtttggctgtttgtcatttagcctctacctctactgtccagttaacatggaagatgggaaaggatctctcctttgagggcacaaaggaaaagggcacgggagggttcctttgcactacaggctgctgcttacgcacataccttcaagcaggtgcaataaagaacaacctaagttcacctgctgctctgtggatagtggaagtcagagaaggtccctcaccaaatcagcagtcatacaaatagttctgtttctgcggttctgctcagctctgagaagactttgatgatttctggctatttcccccctggaagtgtcttcttttctaccttactttgctctaattgtgtcccattcagctcctatggcctctctcagctgtgtacattggatgggatgttctcattaacttaacacgggcaaggtcagcactggcctctctactaacctatactacttgaccgactttggcaagtatcactaccacacaccagcccgacagagaatgtgaaactactcacttgggatttcatctgggagtgtagcctgttgcgggtgctgtgaagctgtgcaaaacactcgagtttacagaagtctcatttctatgcattcatatgtcctatatttatctgtagctactcttaaccacttgctccacagctatacggtataacattctttcaactcctgatactcccaggttccaagattatttcatgccttgcataatgagtataaatgaccatactttatctatgctatgctcctgggctgatgcttgtaaatgatacagtactggaaatgacagattccaccagaactgatatgtaggacataacctatagctgcagcccagtgctgccattaagtttaaaaacccttccttactcagggagaactgtttttctttcttccctcactgacagctctgatgttctaagtctcacaatctcatacttagtcacagagctgactctctctaggactgaggctgcacctatggatttaaaagccagtttgacccagagcttggagcagaccatgaaagaagtggcaagataaatgaagaggaagaagtgtgcatctctaaagctcttgctgccagactgtttggcgctaccaaaacatttgcccttctgccatctttaggaaagactctgccttaacattattctattccttacagatgacttgggggttcagtcattccttaatccttttgcttccagaaagaactacagttttgctgcacaactaactgtggtcctcgctggaagcaaaaggtgcaaaatagatttaatacccccagtcaccctgtttttgtttttttgcacctttaatttatattttcatattttaaaagctattttctgcaaaaggtcaaaaaaggtgataatttttattttattggtattatgtacataacagaaatgactttcctactgacggcacaatatctacaatatctttttttattattattttccagtgtatgtgtctgcaggactgtatgctttattttgggtttggtactatgggagaaatcctcatgtaaagggatatattctgcattattttgtattgctggttattcagcagaggtctgttactttttttgttttgcttggtaaccccttaactgccagagcaacctgcattttattaatctgttaccttacaaatgattgcaggcgcttcatcgctgaaacaattgacaattattgtaatacgttacactgataagtgctttccctttttataacaagtgtatgccagattgatgcactttttattgacttgtgaatggggtcgggagggatcagcaatggttattgctttggtttcttctctataaatacaagttttcaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGTSNGSKSLTPGPSPPDPSPTAPGCGNGAMMGSFGIFLQGLLAVMAFSILMLKRLREPKHERRPWKIWFLDTSKQAIGMLFIHFANVYLSDLTGEDPCSIYLINFLLDATLGMLLIYIGVRVVSCIVEWRQWESLRFGEYGEPMQCKAWVGQCALYIVIMMFEKAAIILVLLIPHLKEVAKVKPIKKPSAGTCNCHADCPVLC
Donor tissue: