ORFeome > MGC89012 – XORFeome 2.0

MGC89012 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89012 protein, mRNA (cDNA clone MGC:89012 IMAGE:7004540), complete cds
Gene Symbol: MGC89012
Gene ID: 448263
ORF gb_acc: MG134153
ORF ID: 11783

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075329

Library Location

Plate ID: GDExt11017
Well Location: B09

EST Sequences

Clone: MGC:89012 IMAGE:7004540
Trimmed Sequence: ATGCAGCGGGGGTCCCTGGCTAGGGGCGAAGATGAAGACCGCCGGGCAAGCACCGTGCCTTATTCTCACCCAGAGCAGCCCCCCCCCATCCCCGTGTTCATCTTTCCCCCCAGACTGGACTTTTATGCTGACGATCAAGTCAGTCACAAGCAGGTGCTCACCCTGTATAATCCCTTCACCCACGTGCTCCGATTCAAAGTTCTATGCACAGCCCCATTACGTTACACAGTGGTGGAAGCTGAAGGCCTGGTGAAGCCCAATTCCTGCATAGACATAGTGACGCGGCACCGGGATATCCGCGCACGGAACTACGGGACTACGGATAAGTTTCGCGTGGAGGTTTGGGAGGAAGGAGCGAGTAGGGGCAGGGGGGGCAGGAAGGACATCGCAGCCACATTACATGCCACAAAGCCGCAGGCAGCAGAGCGGCCCCCCCACGTGTCCCTGCCGTGGCACCCCCCCTCACATGTCTATTCCATGCAACACGGATTCCCTCGCACTCTCTCCCCGTGGTTATTTGGGCTGTACATCTTGGCCGGGCTGGTTTCCATGGTGATCCTGATCTTGCCGTTGCACGGAGACACGCGGAGCCTCTTGCACGAGAACCTGCAAGTGTCGGTGGTGCAGAAACTGGTGGCGGCCTACGTTCTAGGGCTCCTGACTATGGTTTTCCTACAAGGGTGA
Full Trace Sequence: ggccctgctgatggcggaagctgcagggcgctagatgcagtcgccggatggagtttggagtcgccatgtatttgtgcccctaatgcccatgtacccacagcgccatgcagcgggggtccctggctaggggcgaagatgaagaccgccgggcaagcaccgtgccttattctcacccagagcagcccccccccatccccgtgttcatctttccccccagactggacttttatgctgacgatcaagtcagtcacaagcaggtgctcaccctgtataatcccttcacccacgtgctccgattcaaagttctatgcacagccccattacgttacacagtggtggaagctgaaggcctggtgaagcccaattcctgcatagacatagtgacgcggcaccgggatatccgcgcacggaactacgggactacggataagtttcgcgtggaggtttgggaggaaggagcgagtaggggcagggggggcaggaaggacatcgcagccacattacatgccacaaagccgcaggcagcagagcggcccccccacgtgtccctgccgtggcaccccccctcacatgtctattccatgcaacacggattccctcgcactctctccccgtggttatttgggctgtacatcttggccgggctggtttccatggtgatcctgatcttgccgttgcacggagacacgcggagcctcttgcacgagaacctgcaagtgtcggtggtgcagaaactggtggcggcctacgttctagggctcctgactatggttttcctacaagggtgacgcagcagggactgcagagcgcaatcggccggcaccagtgcaactgcacctcccactggaacaaaccatggaagcagggagggttcagcatggtgtgggtaggggatctgttatctggaaacctgccagtcccgttacccagcgtgttctattaaaatgacttccccccccccgccccatttcatataatcgatcccacgctgtactgccaccctgagagacgggtgcccctgtattgtgtccatagagacagtgcccccctccccccccaatactgtgtctcagatctgcagaaccaataaagtgatcagccgggaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MQRGSLARGEDEDRRASTVPYSHPEQPPPIPVFIFPPRLDFYADDQVSHKQVLTLYNPFTHVLRFKVLCTAPLRYTVVEAEGLVKPNSCIDIVTRHRDIRARNYGTTDKFRVEVWEEGASRGRGGRKDIAATLHATKPQAAERPPHVSLPWHPPSHVYSMQHGFPRTLSPWLFGLYILAGLVSMVILILPLHGDTRSLLHENLQVSVVQKLVAAYVLGLLTMVFLQG
Donor tissue: