ORFeome > MGC89063 – XORFeome 2.0

MGC89063 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89063 protein, mRNA (cDNA clone MGC:89063 IMAGE:7005751), complete cds
Gene Symbol: MGC89063
Gene ID: 448288
ORF gb_acc: MG134108
ORF ID: 11732

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075360

Library Location

Plate ID: GDExt11017
Well Location: F06

EST Sequences

Clone: MGC:89063 IMAGE:7005751
Trimmed Sequence: ATGGCTGAGAAGTTTGACAACCTGGAGGAACATTTAGAGAAGTTCGTGGAGAACATTCGCCAGCTGGGAATCATTGTTAGCGACTTCCAGCCCAGCAGCCAGGCTGGTCTTAATCAGAAGCTAAATTTTTTGGTAACCGGCTTGCAAGATATTGACAAATGTCGACAACAACTTCATGATATCACTGTACCCTTGGAAGTTTTTGATTACATTGATCAAGGGCGCAATCCACAACTTTACACCAAGGAGTGCTTGGAAAGAGCTTTGGCTAAAAACGAGCAAGTCAAAGGGAAAATTGATACCCTAAAGAAATTTAAGAGTCTGTTAATTCAAGAATTAAGCAAGGTTTTTCCAGAAGACATGGCAAAGTACAAAGCAATAAGAGGGGAAGATCATCCTCCTTCATAA
Full Trace Sequence: gacagtgcttccactgttctggctcattatattattttatagaaaaagatagtgattgagggttggtaggaaaggacaggaaacgattggtgccagcaggaaagtgtgtgggctcaggagccagaatggctgagaagtttgacaacctggaggaacatttagagaagttcgtggagaacattcgccagctgggaatcattgttagcgacttccagcccagcagccaggctggtcttaatcagaagctaaattttttggtaaccggcttgcaagatattgacaaatgtcgacaacaacttcatgatatcactgtacccttggaagtttttgattacattgatcaagggcgcaatccacaactttacaccaaggagtgcttggaaagagctttggctaaaaacgagcaagtcaaagggaaaattgataccctaaagaaatttaagagtctgttaattcaagaattaagcaaggtttttccagaagacatggcaaagtacaaagcaataagaggggaagatcatcctccttcataaaaatattccccactctaaggagatggagaattctccattaaaaaaaaacccagaaggatttgccctcagacaggagtagaatattatcatggaaattttaatggcagttcattttaatggaaactcctcctctgcaatgaatggaatgagtgtatgattacaaaaactgacaggccaatatggaacatgtctacaccaagcacacaaaaatcacaattacatgcaactgtgaatacatctgtaataaactgagcaaacagagaaggatcaaaaacagatacagatgttttttctgccagaggagaggatgcataaagcaggatgccctttaaattcatactatgttgctgaatcaggtctcttggcttcatcaaacatatccatggagaaacttaacatccactggaagaattatgttggatatttaactacataaagcattgcgtagcaaggaaatattgaccaataggttccagttaatgggacgatgtatatttgcgttgcaattgtcagaacttctttgtcaatttggatcatttactttgtctcactattcgtatgcaacggtatcattgggatggcaacattttataaagcctaatgtattaatctctgtattggttgatgtggtattaataaattctattttggctaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAEKFDNLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFLVTGLQDIDKCRQQLHDITVPLEVFDYIDQGRNPQLYTKECLERALAKNEQVKGKIDTLKKFKSLLIQELSKVFPEDMAKYKAIRGEDHPPS
Donor tissue: