ORFeome > MGC89162 – XORFeome 2.0

MGC89162 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89162 protein, mRNA (cDNA clone MGC:89162 IMAGE:7016156), complete cds
Gene Symbol: MGC89162
Gene ID: 448331
ORF gb_acc: MG134191
ORF ID: 11836

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075410

Library Location

Plate ID: GDExt11018
Well Location: B01

EST Sequences

Clone: MGC:89162 IMAGE:7016156
Trimmed Sequence: ATGGAAAAACCACCGACCATGGGAATTTCTCTTCCAAGTCTCTTTTGTCTGATTCTTGTTGGGATCACAATATCCTGCCGTGCCCAAGACACGTGTCCTGATGTAAAACTCATTGGAGCTGGAGAATCAGCAAGAATGGCCATTGTAAGAGGGTGTCTGGGGTCTACAGGATCCACTGGGCAAAAGGGAGAAGCAGGGACACAAGGAACCAAAGGAGACCCTGGAATCCCTGGAATGTTGGGCCCCCGGGGTGAGAAAGGAGACATGGGGCCTCCTGGACCCTGGGGGCCACCTGGAGTGAAAGGAGACATTGGGCGTCCTGGACTCTTGGGGCCACTTGGCAAGAAAACTCCCAAGAACTGTGTGGAGCTGCTCAATAATGGAGCCACGCTCACCGGCTGGTACACAGTCTCTCCGGATGGTAATAAGCCTATAAAGGTTCTCTGTGACATGGATACGGATGGGGGGGGATGGATAGTGTTTCAGAGACGAGTGGACGGTTCTGTGGATTTCTACAGAGACTGGAAATCCTACAAACAAGGTTTTGGCAGCCAAGTGGGCGAGTTCTGGTTGGGAAATGAGAACATTCACCTCCTTACGTCCTCAGGGAATTTCCAACTGCGCTTCGACCTGGAGGATTTTGACAACAATCGAAAGTACGCCACCTACAGCCAATTCCGACTGGAGGGAGAGTCTCAGAAATACACCCTACGTTTTGGGGAATTCACTGGGGGCCCTGCAGGGGACTCCTTGTCTTCTCACAACAACAAAGCTTTCCAAACAAAGGATGTGGATAATGATGAGAGTGATAGTAACTGTGCAGAGTCATTCAAAGGGGCCTGGTGGTATCACGATTGTTACTCCTCCTGTCTGAATGGGGAATATTTGCGAGGAGAACACGATGAGGCAGATGGAGGAGTCAACTGGGGCGAATTCAGAGGGAATGATTACTCACTGAAAGTGTCTGAAATTAAGTTCCGGCCACAATAG
Full Trace Sequence: taaagagccacggatctgtgcagtctcataaatggaaaaaccaccgaccatgggaatttctcttccaagtctcttttgtctgattcttgttgggatcacaatatcctgccgtgcccaagacacgtgtcctgatgtaaaactcattggagctggagaatcagcaagaatggccattgtaagagggtgtctggggtctacaggatccactgggcaaaagggagaagcagggacacaaggaaccaaaggagaccctggaatccctggaatgttgggcccccggggtgagaaaggagacatggggcctcctggaccctgggggccacctggagtgaaaggagacattgggcgtcctggactcttggggccacttggcaagaaaactcccaagaactgtgtggagctgctcaataatggagccacgctcaccggctggtacacagtctctccggatggtaataagcctataaaggttctctgtgacatggatacggatggggggggatggatagtgtttcagagacgagtggacggttctgtggatttctacagagactggaaatcctacaaacaaggttttggcagccaagtgggcgagttctggttgggaaatgagaacattcacctccttacgtcctcagggaatttccaactgcgcttcgacctggaggattttgacaacaatcgaaagtacgccacctacagccaattccgactggagggagagtctcagaaatacaccctacgttttggggaattcactgggggccctgcaggggactccttgtcttctcacaacaacaaagctttccaaacaaaggatgtggataatgatgagagtgatagtaactgtgcagagtcattcaaaggggcctggtggtatcacgattgttactcctcctgtctgaatggggaatatttgcgaggagaacacgatgaggcagatggaggagtcaactggggcgaattcagagggaatgattactcactgaaagtgtctgaaattaagttccggccacaataggaacagagaataatcgaatccagagtatcttatccggtgaggtcgtgttattctttcatgggaaattaacacttggaattgtgttggaatgattgcctgggaatgtaccattgctgctcggggatgttgggcagttatggctttagtcgctactctatgatttgtgcagttatttctgcctaaaataaagttgcttctgcgtctcagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEKPPTMGISLPSLFCLILVGITISCRAQDTCPDVKLIGAGESARMAIVRGCLGSTGSTGQKGEAGTQGTKGDPGIPGMLGPRGEKGDMGPPGPWGPPGVKGDIGRPGLLGPLGKKTPKNCVELLNNGATLTGWYTVSPDGNKPIKVLCDMDTDGGGWIVFQRRVDGSVDFYRDWKSYKQGFGSQVGEFWLGNENIHLLTSSGNFQLRFDLEDFDNNRKYATYSQFRLEGESQKYTLRFGEFTGGPAGDSLSSHNNKAFQTKDVDNDESDSNCAESFKGAWWYHDCYSSCLNGEYLRGEHDEADGGVNWGEFRGNDYSLKVSEIKFRPQ
Donor tissue: