ORFeome > MGC89259 – XORFeome 2.0

MGC89259 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89259 protein, mRNA (cDNA clone MGC:89259 IMAGE:6976489), complete cds
Gene Symbol: MGC89259
Gene ID: 493551
ORF gb_acc: MG133831
ORF ID: 11408

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082514

Library Location

Plate ID: GDExt11013
Well Location: H10

EST Sequences

Clone: MGC:89259 IMAGE:6976489
Trimmed Sequence: ATGGCGGGTATTGGCAAGGTGATCTTCCGCATCATGATCGCCATCATCGTTATCCTGGTGCTGCTAATCGCTCTCATTATTGGCATTGGCATCGCAGGGAGCAAGATAACCATCGCGGTGACGGGGGTGTACACGGTGGGGCGCATAAGCGACGACGTGATTCTCGGCTGCACGTTCATCCCAGATACAACTCAGGCCAACAACATCCAGTGGGAGAAGGTGGGCACCAGCGGGGTGGTGTATAAGTACGAGAATGGAAAGAGCTTGTTGAACGATCAGAACGCGGCCTTCAAGGGGCGAGCCTCACTCTTCCTCGGGGAAATCATTAACGGCAACGCCTCCCTGAAGCTCACCCAGGTCAAACTGTCCGACGCCGGCACCTACAGGTGCATCATCACCAACTCCAAAGGCACCGGAGACGACACATTGACGTTCAAGGTTGGAGGTTACACTTCTGTGAGTGTGAGCAGCCCCTCCAATGACACCCTCCGTTGTTCGTCTTCATACTGGTACCCCAAACCCAATGTCACTTGGGTGAGGGACTCAGGAGCCAACATCACCAACGTCACCATCAAAACCAGCTTCCCGCCGGCGCTCAATAACCTCACCGATGTGACTACAGAACTCAGCGGGGCCCAACTGGACGTGCAGTACTCCTGCCTGATACACACGGACCTGGCGCAGGCAGTGGGGGTCTCAATGCTTACAGAGTTTGGGCTCCAAACCACATCCGAACTGACTGTATTTAACTGTACGGATCCTCTCGCTGCGACTTACCTCTCGGTCTGGGCCCTCCTCCTCTGTCTCCTTCTGGGCTCTACCCATCACTAG
Full Trace Sequence: agaacgttacagtgtaaccagcacatgaggggaccccagagcccaaactgagccccccgtctgggtgccagggccagtgggcaacatggcgggtattggcaaggtgatcttccgcatcatgatcgccatcatcgttatcctggtgctgctaatcgctctcattattggcattggcatcgcagggagcaagataaccatcgcggtgacgggggtgtacacggtggggcgcataagcgacgacgtgattctcggctgcacgttcatcccagatacaactcaggccaacaacatccagtgggagaaggtgggcaccagcggggtggtgtataagtacgagaatggaaagagcttgttgaacgatcagaacgcggccttcaaggggcgagcctcactcttcctcggggaaatcattaacggcaacgcctccctgaagctcacccaggtcaaactgtccgacgccggcacctacaggtgcatcatcaccaactccaaaggcaccggagacgacacattgacgttcaaggttggaggttacacttctgtgagtgtgagcagcccctccaatgacaccctccgttgttcgtcttcatactggtaccccaaacccaatgtcacttgggtgagggactcaggagccaacatcaccaacgtcaccatcaaaaccagcttcccgccggcgctcaataacctcaccgatgtgactacagaactcagcggggcccaactggacgtgcagtactcctgcctgatacacacggacctggcgcaggcagtgggggtctcaatgcttacagagtttgggctccaaaccacatccgaactgactgtatttaactgtacggatcctctcgctgcgacttacctctcggtctgggccctcctcctctgtctccttctgggctctacccatcactaggtgcccaatggaaacatctcactgcccggtgtgtccaggttctaataacaggccttgtataatagggtctccacctgggcccaaacccatcacccactgtggggtctcatccccaggtctgcggctgctacagagaatttattatcttctggtcatggaatctccaggggccccggggccagacactcagaggatcaggctggagggaggatttcacatcggaccatatgggccatggaggggctcaatgtgggtttgtcggaaccattttaccggttcaaggatggcggccttgggaaatctgagatgtggttattgtgatatcaggttctgctgaagcccagtctgacccagatggatataagaggatggaggccttgtccatgttccccaggagcttatggaccatcaggagttaaagtaatggactaaaacctcacttggataatttcctagaaccggtcactgttgggtttctgtgggaccttcagtttgtccctgtggaactgggccttgggctctaataccaatatctgaagaaccttacagagaacattcctgaccctctcgtggtgtcctactatcaaggtctggggataatacagactgatataaagtgttgttccaaactgaagtccatttagaagccaaatggaaataccaggaggtgaaagtgtcagttatttcctgttgcctttatactgcccctttaatgccatattgccctgaaatatttcctatttaaatagagcctatgccgttcccaggtgtggggacaggaataaccggtctgttataatctgagatgtcttctctattcttgtgttaatttattgttccatgtcgaacctcgacggcgaataaactgctggtcaaaatgttgttgggcaaaaaaaaaaaaaaaaaaaaa
Translation: MAGIGKVIFRIMIAIIVILVLLIALIIGIGIAGSKITIAVTGVYTVGRISDDVILGCTFIPDTTQANNIQWEKVGTSGVVYKYENGKSLLNDQNAAFKGRASLFLGEIINGNASLKLTQVKLSDAGTYRCIITNSKGTGDDTLTFKVGGYTSVSVSSPSNDTLRCSSSYWYPKPNVTWVRDSGANITNVTIKTSFPPALNNLTDVTTELSGAQLDVQYSCLIHTDLAQAVGVSMLTEFGLQTTSELTVFNCTDPLAATYLSVWALLLCLLLGSTHH
Donor tissue: tailbud