ORFeome > MGC89265 – XORFeome 2.0

MGC89265 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89265 protein, mRNA (cDNA clone MGC:89265 IMAGE:6976792), complete cds
Gene Symbol: MGC89265
Gene ID: 448377
ORF gb_acc: MG133813
ORF ID: 11387

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075463

Library Location

Plate ID: GDExt11014
Well Location: H01

EST Sequences

Clone: MGC:89265 IMAGE:6976792
Trimmed Sequence: ATGGCTGAGCCAGAAGGGAGAAGTCTGGACGACTTTTTCGCGAAGAGGGACAAGAAGAAGAAGAAAGATAAAGGAGGGCCAGTGAGTGCGGCAGGAAGCCGTGGGGCAACAAGGCCGCCTGACGGGGCACCTTCATCATTTTCATCTTCCGCCTCCTCCATGTCCGGAGCAGGGAAAGGCATAAAGAAGGAAAAGTCTGGGAAGAGCGAGAATCCAGATCAACTACAGGAAAAAGAAGATGATGAATGGAAAGAATTTGAGCAGAAAGAAGTTGATTACTCTGGCCTTAGGATTCAGTCATTACAAATAAGCAATGAAAAAGATGATGATGAATATGAAAAGAAGGAAGAACAAGGAGCAGACTGGGAAGATATTGGAGGTTGTGGCACAGACAAGTCATCTGGTCCTTGGAATAAGACTGCTCAGGCCCAGGCTCCCATAAGTGCTGTTATAGAAGCTCCAGAGCCGGTACATACTGGTGGTGTATATCGACCTCCTGCAGCCAGAGCCTCTGTTGCAACACGAAAACCCCAGGGTCCACCCGAAATTTTTAGTGATACACAGTTTCCATCGCTTCAAGCCACTGCCAAACACATAGAGTCCCGCAGGGATAAAGAAATGGAGAAGACTTTTGAAGTAGTAAAGCATAAAAATCGTGCAAGGGATGAAGCGGCCAAGAACCAAGCCCTCCGACTTCAGTTAGACAACCAGTATGCGGTTTTAGGCGAACAGTAA
Full Trace Sequence: cgcgtgttgggcgctgagcgaagtgtcctgttagcgcttccaataactctcgccgccatggctgagccagaagggagaagtctggacgactttttcgcgaagagggacaagaagaagaagaaagataaaggagggccagtgagtgcggcaggaagccgtggggcaacaaggccgcctgacggggcaccttcatcattttcatcttccgcctcctccatgtccggagcagggaaaggcataaagaaggaaaagtctgggaagagcgagaatccagatcaactacaggaaaaagaagatgatgaatggaaagaatttgagcagaaagaagttgattactctggccttaggattcagtcattacaaataagcaatgaaaaagatgatgatgaatatgaaaagaaggaagaacaaggagcagactgggaagatattggaggttgtggcacagacaagtcatctggtccttggaataagactgctcaggcccaggctcccataagtgctgttatagaagctccagagccggtacatactggtggtgtatatcgacctcctgcagccagagcctctgttgcaacacgaaaaccccagggtccacccgaaatttttagtgatacacagtttccatcgcttcaagccactgccaaacacatagagtcccgcagggataaagaaatggagaagacttttgaagtagtaaagcataaaaatcgtgcaagggatgaagcggccaagaaccaagccctccgacttcagttagacaaccagtatgcggttttaggcgaacagtaaagcggcaaatacaaatttattgtattttataaatatatatatttttttttttttactgacccaccaaggtaagcaaactacagctctcaaaatatgaacagaaacttgttggaactgtccgatgtcctgcgttatgaacttgatgaaaaataatcggaatattaaaacatcacagccctttaggtatttttttcctgaatctgggaatgggtgcctctcaaggcactgaaaactgttcatgaattcccaacattttgaaaaccttacacatcaaagaagagaattgagaaatcagcattcagtggtcataatcaaaatatttttatgctgagccttgactaaggttgactacctcagatttgctgtgcgtaatgcggacaccacatggattgcaagctctttgggaaaagtcagctcttcagattgttgtctgctttcagtgtcaatgatttaagtgaccttaaagggattattagtagaagtaccattaaagtctttacagtttttatataggtctgcaattggtacgggtctctaaagaaattctaatccttgatagtgcaaagctgtagtttgttacccttttaaagggcaaaacgcatcagaaactgcaagagaagggtacaatgtctggcttattggcttgcttcctgctgttaacctctaaaagtatccattgcctactcaagggcaagtctctgtaatgtttaaatattcattctagaagtgccacactcactggggcaataaacctgcactggctaatgagtaaagagatttgcagtgtgctttatgcagatttacagatttcaggctggtgtgtaatgcatcagctaataacaagcaaattgggttattctgcatttcaatgggtccccatcagatggcttgttgctggtaattggatgccaattatttgttaaattggagaataagacatgttgtctgggttgggcacacacggcaacaatgtcatttaaaggtgagctccacccaaaaatacattttacatcaataattactcagtacaaataaaactaataattaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAEPEGRSLDDFFAKRDKKKKKDKGGPVSAAGSRGATRPPDGAPSSFSSSASSMSGAGKGIKKEKSGKSENPDQLQEKEDDEWKEFEQKEVDYSGLRIQSLQISNEKDDDEYEKKEEQGADWEDIGGCGTDKSSGPWNKTAQAQAPISAVIEAPEPVHTGGVYRPPAARASVATRKPQGPPEIFSDTQFPSLQATAKHIESRRDKEMEKTFEVVKHKNRARDEAAKNQALRLQLDNQYAVLGEQ
Donor tissue: tailbud