ORFeome > MGC89599 – XORFeome 2.0

MGC89599 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89599 protein, mRNA (cDNA clone MGC:89599 IMAGE:6995029), complete cds
Gene Symbol: MGC89599
Gene ID: 448479
ORF gb_acc: MG133917
ORF ID: 11510

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075594

Library Location

Plate ID: GDExt11015
Well Location: D03

EST Sequences

Clone: MGC:89599 IMAGE:6995029
Trimmed Sequence: ATGGGAAAGCAGAAAAAAACGAAGAAATATGCAGTAATGAAGAAGAGGATTAGCCTTAAAGACCAACGCATCAAGGAGAAAGATAGAGCAAAAATTCAGCCGAAAAAGGAAGACTCAAGTGCCATCAAAGAAAGAGAAGTACCTCAGGTCCCGTCATGTCTTTTCTTCCAATATAATACCAACTTGGGGCCACCCTACTACATTCTGGTGGATACCAATTTCATCAACTTTTCCATCAAAGCAAAACTGGACCTAGTGCAATCTATGATGGACTGCCTTTATGCTAAATGTGTCCCCTGTATAACAGACTGTGTGATGGCTGAATTGGAGAAACTGGGACAAAAATACAGAGTGGCTTTGAGGATTGCAAAGGACCCATCCTTTGAGCGACTTCCTTGCTCTCATCCTGGAACCTATGCAGATGACTGCCTTGTACAAAGAGTTACTCAGCATAAGTGCTATATTGTGGCTACAGTGGACAGAGACCTGAAAAGAAGAATCCGTAAAATCCCTGGTGTTCCCATCATGTACATTTCAAACCACAGATATAATATTGAACGAATGCCAGATGACTATGGAGCTCCACGTTTTTAA
Full Trace Sequence: ggacttatttcctgcatattcggtgacgttaacagtgtgcgaccggaagcacacggcatctaaactttggcagcagcatgggaaagcagaaaaaaacgaagaaatatgcagtaatgaagaagaggattagccttaaagaccaacgcatcaaggagaaagatagagcaaaaattcagccgaaaaaggaagactcaagtgccatcaaagaaagagaagtacctcaggtcccgtcatgtcttttcttccaatataataccaacttggggccaccctactacattctggtggataccaatttcatcaacttttccatcaaagcaaaactggacctagtgcaatctatgatggactgcctttatgctaaatgtgtcccctgtataacagactgtgtgatggctgaattggagaaactgggacaaaaatacagagtggctttgaggattgcaaaggacccatcctttgagcgacttccttgctctcatcctggaacctatgcagatgactgccttgtacaaagagttactcagcataagtgctatattgtggctacagtggacagagacctgaaaagaagaatccgtaaaatccctggtgttcccatcatgtacatttcaaaccacagatataatattgaacgaatgccagatgactatggagctccacgtttttaagacttgcttgatcaacattccaaacttcactatgatatggacattaagcagttatgctctgttacatgaaagctctgggacaaaggaattagcaataagttgtcggaaccagtccaggaaaagattctatagatctacttcaaggactgttatctgtttttgcttctattagctgttcctgctggggcctagtgatttttttcctagaaatccatctcacttcacttcatggctcccaaattaaacattcttgaattctgcatatacaccctaccctttaccaatgcattcagtgttccactctgcgtaagctacaaaagttattctttctacattttctgccacattacatctattacaacatgcttaaatgataatccttttccaagccagtcttcaatgaggagctcagagtacacagcagacctaagttaaattggaatatctggtcttttggcaaagtaatgaaactagtagttctttgcctgaaatggcctacatcagccaaatattgggaaagaccatagaaaagggactgcatccacaatttgatgcaatccttgctgaacaggatttctaacctttctgattgataactgattcagaaaatattggtcgttgaagctgtcgttctggctttatactgtggtaactcaggagttgctgatacagcaaccagtcagttttattagagtaatgtagttatcattatgatgtgtacaataaaactatttccagtctggctcaaaaaaaaaaaaaaaaaaa
Translation: MGKQKKTKKYAVMKKRISLKDQRIKEKDRAKIQPKKEDSSAIKEREVPQVPSCLFFQYNTNLGPPYYILVDTNFINFSIKAKLDLVQSMMDCLYAKCVPCITDCVMAELEKLGQKYRVALRIAKDPSFERLPCSHPGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF
Donor tissue: neurula