ORFeome > MGC89648 – XORFeome 2.0

MGC89648 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89648 protein, mRNA (cDNA clone MGC:89648 IMAGE:7025862), complete cds
Gene Symbol: MGC89648
Gene ID: 448655
ORF gb_acc: MG133112
ORF ID: 10546

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077002

Library Location

Plate ID: GDExt11005
Well Location: A09

EST Sequences

Clone: MGC:89648 IMAGE:7025862
Trimmed Sequence: ATGGCTCCGAAAGGTGGTAACAAGCAGCAGTCCGAGGAAGATCTGCTTTTGCAGGATTTCAGCCGCAACCTGTCGGCTAAATCTTCAGCGCTTTTCTACGGCAATGCTTTCATCGTGTCTGCAATCCCCATTTGGCTGTATTGGAGAATATGGCACATGGATCTGGTGCAGTCGGCTGTGCTATATACAGTAATGACGCTGGTCAGCACCTACCTTGTGGCTTTTGCATACAAGAATGTTAAATTTGTCCTCAAACACAAGGTGGCGCAGAAACGCGAAGATGCTGTTTCTAGAGAAGTGACCCGAAAACTTTCGGAAGCAGACAATAGGAAGATGTCCAGGAAGGAAAAGGATGAAAGGATCCTTTGGAAGAAAAATGAAGTCGCTGACTATGAGGCAACTACATTCTCCATTTTCTACAATAATACATTATTCCTGGTTTTGGTGATTGTTGCTTCTTTCTTTCTTCTGAAGAACTTCAACCCCACGGTAAATTACATTTTATCTATAAGTGCTGCCTCTGGACTTATTGCTCTGCTTTCTACAGGATCAAAATAA
Full Trace Sequence: attctgaccccgcccattttccaagcgcttccgctccctgagtgctgacgaatcagtacagagatttctctgacggtggctgaggagggtcattcagtgtgagacgtgtctctactgttcattctctctccgataccggccatggctccgaaaggtggtaacaagcagcagtccgaggaagatctgcttttgcaggatttcagccgcaacctgtcggctaaatcttcagcgcttttctacggcaatgctttcatcgtgtctgcaatccccatttggctgtattggagaatatggcacatggatctggtgcagtcggctgtgctatatacagtaatgacgctggtcagcacctaccttgtggcttttgcatacaagaatgttaaatttgtcctcaaacacaaggtggcgcagaaacgcgaagatgctgtttctagagaagtgacccgaaaactttcggaagcagacaataggaagatgtccaggaaggaaaaggatgaaaggatcctttggaagaaaaatgaagtcgctgactatgaggcaactacattctccattttctacaataatacattattcctggttttggtgattgttgcttctttctttcttctgaagaacttcaaccccacggtaaattacattttatctataagtgctgcctctggacttattgctctgctttctacaggatcaaaataaatggacaaggttatttcaaagacattcataaaaaagggttgttttcttttttttaacaaactatgtaaaataaacatcttttttgtttgtaaaaaaaaaaaaaaaa
Translation: MAPKGGNKQQSEEDLLLQDFSRNLSAKSSALFYGNAFIVSAIPIWLYWRIWHMDLVQSAVLYTVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSREVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFLLKNFNPTVNYILSISAASGLIALLSTGSK
Donor tissue: