ORFeome > MGC89688 – XORFeome 2.0

MGC89688 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89688 protein, mRNA (cDNA clone MGC:89688 IMAGE:7026410), complete cds
Gene Symbol: MGC89688
Gene ID: 493259
ORF gb_acc: MG133066
ORF ID: 10482

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080139

Library Location

Plate ID: GDExt11005
Well Location: H05

EST Sequences

Clone: MGC:89688 IMAGE:7026410
Trimmed Sequence: ATGACCAAGGTTTGTGCTGTTTTTGGAGGATCTAGGGGAATAGGTAAAGCTGTGTCTAAATTGTTGGCTCAGAGAGACTATAAAGTTGCAGTTATATCTAGGGACCTGGAAGTAGCTAAAGCAGCAGCAGCAGAGGTTGGAGCTCACCTGGCCCTCAGCTGTGATGTTTCCAAGGAAAATGAGATCCAGGACACATTCAAAGAAATTACGAACAATTTGGGCAACGTTGACTATCTTGTTAATTCAGCAGGCATCCGTAGAGATGCTTTGTTACTAAGAACAAGATCTGAGGACATAAGGTCTCTCCTCTCTGTCAATCTGGTGGGCACAATCCAAACATGCAAGTTGGCACTAAGGAGTATGATTCAGCAGCAAGGAGGGGCCATTGTAAACATAGGAAGCATTGTTGGTCACAAAGGGAATATTGGTCAGAGCATTTACGGTGCCAGTAAGGAAGGATTAATTGGATTCTCCAAGTCCCTCGCTAAAGAAGTGGCAAAGAGGAACATCCGTGTTAATGTAGTCGCACCAGGATTCATTCACACTGATATGACTTTAGGTTTAGAAGAAGATTCCCTGACTAAAATGGTCCCCTTGGGCAGGTTTGGAGATCCAGAAGAAGTTGCCCAGTCAGTCCTCTTTCTATTGGAATCCCCCTATATCACAGGGCATGTTTTAGTGGTTGATGGTGGCCTCCAGCTACAAATGTAG
Full Trace Sequence: cccctggccccgtagttgaatggcgctgctggaaagatgaccaaggtttgtgctgtttttggaggatctaggggaataggtaaagctgtgtctaaattgttggctcagagagactataaagttgcagttatatctagggacctggaagtagctaaagcagcagcagcagaggttggagctcacctggccctcagctgtgatgtttccaaggaaaatgagatccaggacacattcaaagaaattacgaacaatttgggcaacgttgactatcttgttaattcagcaggcatccgtagagatgctttgttactaagaacaagatctgaggacataaggtctctcctctctgtcaatctggtgggcacaatccaaacatgcaagttggcactaaggagtatgattcagcagcaaggaggggccattgtaaacataggaagcattgttggtcacaaagggaatattggtcagagcatttacggtgccagtaaggaaggattaattggattctccaagtccctcgctaaagaagtggcaaagaggaacatccgtgttaatgtagtcgcaccaggattcattcacactgatatgactttaggtttagaagaagattccctgactaaaatggtccccttgggcaggtttggagatccagaagaagttgcccagtcagtcctctttctattggaatccccctatatcacagggcatgttttagtggttgatggtggcctccagctacaaatgtaggatttttaatgtcccaaaatatatatcaaaacatgtgaattcctgatggtgtaaatggtttaaacttttatattgattattatgattactgtttctttaaataactattataagaatagtaaatgttgttcagatattattgtatatataaaatctcacttaggaagttgttcagtgtgggtttcatttaccttaagcatactttatgtatggctgcaccaagttgctttttacattgaataaaaagaatatagttatggctaatgaagcaaaatcagacagaaggactccacattctcaagggctgtttttgttaacttacacatggaaggctgcacccatatacactagcaaaatgtgtttcctgtaacattatgccatcccctgtgatcagttcttaattgatgctaattcaccatgaagcaggaagatcgtcagaaagatacttttaagttatgcaaaaaagaacaggaagccaacgatggactggccagcatctcaacagccctcaaccctagtgagctttttgggaagagcttcactgtaagatcagcagaaaagtccatgtcagtcagtcacatccctagaagagctacagaaagtgtgggttgaagtttcccctgcaaaaggcctcaaaaacagaacacagtccaaattaacagatatcagtaagggcccatgaagtttggtttggggatgatttaattcactgagctgcattcttgccctataccctatttgagtaatataatacatacaacccatctatttaatcatatttgttatatctaggaattatatgcacagtcatgtgacactgtatatcattctttgtgggtaataaatgattttcagtgcaaaaaaaaaaaaaaaa
Translation: MTKVCAVFGGSRGIGKAVSKLLAQRDYKVAVISRDLEVAKAAAAEVGAHLALSCDVSKENEIQDTFKEITNNLGNVDYLVNSAGIRRDALLLRTRSEDIRSLLSVNLVGTIQTCKLALRSMIQQQGGAIVNIGSIVGHKGNIGQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDMTLGLEEDSLTKMVPLGRFGDPEEVAQSVLFLLESPYITGHVLVVDGGLQLQM
Donor tissue: