ORFeome > MGC89694 – XORFeome 2.0

MGC89694 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89694 protein, mRNA (cDNA clone MGC:89694 IMAGE:7026503), complete cds
Gene Symbol: MGC89694
Gene ID: 448707
ORF gb_acc: MG133054
ORF ID: 10459

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077661

Library Location

Plate ID: GDExt11005
Well Location: E06

EST Sequences

Clone: MGC:89694 IMAGE:7026503
Trimmed Sequence: ATGGCTTCCCGTGCCCTCTGTGTGTGTGTCCGCGCTGCTCTCCGTCCCCTCCCCCGGCGAGCTTTGCCGGCACTGAGCCTTGCTGCATGTCGGACACGCTCCTCCTTGGCACGGCCATCTACGGCCGCTCCTATACTCGTACCGCAGGTTTCCACCTCCTTATTTCAGTTATGCCGCCAGTATGGAGACCTCCCTCCCCTCACGCTGGAGAACATCGGCGAAAGGGTTTTATATGTTTTGAAGTTGTATGACAAGATCGACCCTGAAAAGCTCTCAGTCGGCTCTCATTTTATGAAAGACCTTGGCTTGGATAGTTTGGACCAAGTAGAGATAATCATGGCAATGGAAGACGAGTTTGGCTTTGAAATTCCAGATGCAGACGGGGAGAAGCTGATGACACCGCAGGAGATCGTAGATTACATTGCAGATAAAAAAGATGTCTATGAGTGA
Full Trace Sequence: ggccgtggtgcagcttgggtagcagctgtccgccatggcttcccgtgccctctgtgtgtgtgtccgcgctgctctccgtcccctcccccggcgagctttgccggcactgagccttgctgcatgtcggacacgctcctccttggcacggccatctacggccgctcctatactcgtaccgcaggtttccacctccttatttcagttatgccgccagtatggagacctccctcccctcacgctggagaacatcggcgaaagggttttatatgttttgaagttgtatgacaagatcgaccctgaaaagctctcagtcggctctcattttatgaaagaccttggcttggatagtttggaccaagtagagataatcatggcaatggaagacgagtttggctttgaaattccagatgcagacggggagaagctgatgacaccgcaggagatcgtagattacattgcagataaaaaagatgtctatgagtgaagtacaaatgtcagtctccttgttcactgatgcgctctttctgttggtagctcgggtttggcgcatcacaaccgcgcctgcatgtcgtggcacagctgccccccagcacttcttgcaggatcctgtatttaaaactgtctgaatatggtggtctttaataaatgtaaaaaggaaaaaaagaaaaaaaaaaaaaaaa
Translation: MASRALCVCVRAALRPLPRRALPALSLAACRTRSSLARPSTAAPILVPQVSTSLFQLCRQYGDLPPLTLENIGERVLYVLKLYDKIDPEKLSVGSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDADGEKLMTPQEIVDYIADKKDVYE
Donor tissue: