ORFeome > MGC89733 – XORFeome 2.0

MGC89733 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89733 protein, mRNA (cDNA clone MGC:89733 IMAGE:7027091), complete cds
Gene Symbol: MGC89733
Gene ID: 493330
ORF gb_acc: MG133062
ORF ID: 10472

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080466

Library Location

Plate ID: GDExt11005
Well Location: C07

EST Sequences

Clone: MGC:89733 IMAGE:7027091
Trimmed Sequence: ATGGCTGAGAAAGCAAACAACTTTCCTCCACTTCCTCGTTTTATACCACTCAAGCCATGTTTCCACCAAGATTTTGAGAATGACATCCCAGACCTACATCGGACAACTTGCAAGCGTCTCTACTCCCTATGGATGTTGAATAGCATCACTCTGGGCGTGAATCTTATTGGCTGCTTGGCGTGGATGATTGGAGGAGGCGGCGCCATTAACTTTGGCCTTGCAATTCTGTGGGTCATCCTCTTTACACCCTGCTCCTATGTCTGCTGGTTCAGACCAGCTTACAAAGCTTTCAAGACAGACAGCTCATTTAATTTCATGGCTTTCTTCTTCACATTTTCTGCTCAGCTGGTGATCAGTATAATCCAAGCTGTTGGCATTCCAGGCTGGGGTGTCTGTGGCTGGATTGCTACAGTCGGCTTCTTTGGCACAAGTGTTGGTGCTGCAGTGGTAATGCTGTTCCCAACCATCTTGTTTACTGCTGTGGCTGTCCTCTCTTTTGTGGCACTAACTAAGGTTCATAGGTTTTACCGAGGTGCAGGAGGTAGCCTTAGCAAGGCACAAGAAGAATGGACGACGGGAGCCTGGAAGAATCCTCATGTACAGCAGGCAGCTCAGAATGCTGCACAAGGTGCCATGTCGCATAACGACCCTCAGTATTCAGCAACACCAAATTATGGCTACTCTAACTAA
Full Trace Sequence: gagtccgtccgtgggatagaaagctggctgtctctcgctctacttcaactccatttagcgattgttaggcttcaacttaacaggggacttttccctcctgattgccggcacagactctgctgaccatggctgagaaagcaaacaactttcctccacttcctcgttttataccactcaagccatgtttccaccaagattttgagaatgacatcccagacctacatcggacaacttgcaagcgtctctactccctatggatgttgaatagcatcactctgggcgtgaatcttattggctgcttggcgtggatgattggaggaggcggcgccattaactttggccttgcaattctgtgggtcatcctctttacaccctgctcctatgtctgctggttcagaccagcttacaaagctttcaagacagacagctcatttaatttcatggctttcttcttcacattttctgctcagctggtgatcagtataatccaagctgttggcattccaggctggggtgtctgtggctggattgctacagtcggcttctttggcacaagtgttggtgctgcagtggtaatgctgttcccaaccatcttgtttactgctgtggctgtcctctcttttgtggcactaactaaggttcataggttttaccgaggtgcaggaggtagccttagcaaggcacaagaagaatggacgacgggagcctggaagaatcctcatgtacagcaggcagctcagaatgctgcacaaggtgccatgtcgcataacgaccctcagtattcagcaacaccaaattatggctactctaactaaatgtgaggctgtttaaggaccagcaaacaaatattccttgggaagaaggtcctgccctagtagttaacttgttttttttgtttgttttttagtcctcctgttcaccttatatcatggtgtataattgggtgtggcttgtatatatgtttcccagagagaatcagtctcagggtactgcagaatttgcctaagggaaaagttatgtttacatgcagatataaagtatatagctgttttaagcacggtgtaggtaagaactcccacacaactaaatggcaatgacagttaattgggcactgaactaaaatagattaatattcccttgacatttaaactttagacatcactggtgcttatcataaactaacagcagaacaataataatacagtgctttttccatatacactgtggttaagctcagcccactgagaagccctttgtataaatgtactgctgatttgtttgattatgctcatacaaacctgaggtagattttccccaataggcaaaatatatgttcagcacaagccctatttattgaactgatgctaaaaaaaaaagttgtatacaatggagattatgttacctgtaatctttgggggccactgctttactccagtaaccatactggatttagtaacagagaattttttacactccggcatgaaggatccatagaaatagttggtatttaacctagttgttctttctctctttctaatatcagtagcaaatgctaaagtttataattcttgttatagcaatacctacatgtctacaaacgggtacaggaatacccgatgcctaaaaactgacatttactgccttataaaatcttgcttctttctgtgtgtgtgtatatataaataatttacttatatatggttttatgttgatgccctctgccgtttctataatgtttgtatgaccaacttcacaggaccaattcagtagtgacagtctgtttatatcattaaaaatgtgaattatgttaactgttttaacttgaatataaatttaaaaaaactaacaagctaggaaataaaagaaagcagtgtaaaatataagattattatggatctgatgttacgttattgcctgtaatcttcaaaatatgaatttttggatgcaaaactagtggtatgtgtattcataactgattataaacctacattaggaaatatctaaaggttatcaaaaatatttgtaatgattgctttttataattgagaactcttaacaatgtagatagattattaggttaataaataaggctactcatttttcagtattttaattatggtaacaaatgaaaatttcttggtaattacaaaaacctcaaattaaatccaagaagactgcagtcatgcagactggactataaatgtacaaatgattctcattttcctgagccatattcaaagctcccaatggaagggatgtcaggttaccagcttagatttttagctttgtttaaagggtaatataatatcctagtatttaggaaatgtgtaaattgaactttggtaagtcacaaatgtgacataagatgtgattaaaaactgaaataaaaaaatattttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaagaaaaaaaaaaaaaaaa
Translation: MAEKANNFPPLPRFIPLKPCFHQDFENDIPDLHRTTCKRLYSLWMLNSITLGVNLIGCLAWMIGGGGAINFGLAILWVILFTPCSYVCWFRPAYKAFKTDSSFNFMAFFFTFSAQLVISIIQAVGIPGWGVCGWIATVGFFGTSVGAAVVMLFPTILFTAVAVLSFVALTKVHRFYRGAGGSLSKAQEEWTTGAWKNPHVQQAAQNAAQGAMSHNDPQYSATPNYGYSN
Donor tissue: