ORFeome > MGC89830 – XORFeome 2.0

MGC89830 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ribosomal protein S12, mRNA (cDNA clone MGC:89830 IMAGE:7028643), complete cds
Gene Symbol: MGC89830
Gene ID: 493270
ORF gb_acc: MG133179
ORF ID: 10637

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080154

Library Location

Plate ID: GDExt11006
Well Location: C02

EST Sequences

Clone: MGC:89830 IMAGE:7028643
Trimmed Sequence: ATGGCCGAGGAAGGCATTTCTGCTGGAGGTGTAATGGATGTTAACACCGCACTGCAAGAGGTGCTTAAGACTGCTCTCATCCATGATGGTCTAGCACGAGGAATTCGTGAAGCTGCCAAAGCTCTTGACAAGCGCCAAGCTCACCTGTGTGTGTTGGCTTCCAACTGTGATGAGCCAATGTATGTTAAATTAGTGGAAGCCCTTTGTGCTGAGCACCAGATCAATCTTATAAAGGTTGATGACAACAAGAAACTTGGTGAATGGGTTGGTCTCTGCAAGATTGATAGAGAAGGAAAACCCCGCAAAGTGGTTGGTTGCAGTTGTGTAGTTGTCAAGGATTATGGCAAGGAGTCTCAGGCCAAGGATGTCATCGAAGAATACTTCAAGAGCAAGAAATAA
Full Trace Sequence: cgctctttccacagttgttctggatgtggcaggcgatttgacgccttactcccactcctgatccaacgatggccgaggaaggcatttctgctggaggtgtaatggatgttaacaccgcactgcaagaggtgcttaagactgctctcatccatgatggtctagcacgaggaattcgtgaagctgccaaagctcttgacaagcgccaagctcacctgtgtgtgttggcttccaactgtgatgagccaatgtatgttaaattagtggaagccctttgtgctgagcaccagatcaatcttataaaggttgatgacaacaagaaacttggtgaatgggttggtctctgcaagattgatagagaaggaaaaccccgcaaagtggttggttgcagttgtgtagttgtcaaggattatggcaaggagtctcaggccaaggatgtcatcgaagaatacttcaagagcaagaaataaacatctaaaataaaaagtattgagcctgaaaaaaaaaaaaaaaa
Translation: MAEEGISAGGVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFKSKK
Donor tissue: