ORFeome > MGC89995 – XORFeome 2.0

MGC89995 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC89995 protein, mRNA (cDNA clone MGC:89995 IMAGE:7026213), complete cds
Gene Symbol: MGC89995
Gene ID: 448696
ORF gb_acc: MG133055
ORF ID: 10460

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077055

Library Location

Plate ID: GDExt11005
Well Location: B07

EST Sequences

Clone: MGC:89995 IMAGE:7026213
Trimmed Sequence: ATGCCCAAGTCTAAGCGGGACAAGAAGGTTTCCTTAACCAAAACAGCCAAGAAAGGGCTGGAGGTGAAGCAGAATCTCATAGAAGAGCTGCGGAAATGTGTCGACACCTACAAGTACATCTATGTGCTCTCTGTGGAGAACATGAGAAACAACAAACTGAAGGACGTCCGGAACGCATGGAAGCACAGCAGGTTATTCTTCGGGAAGAACAAGGTGATGATGGTGGCGCTGGGGAAAGGAGTCAGTGATGAATACAAGGATAACTTGCACAAGCTGAGCAAGTGCCTGAAAGGCGAAGTCGGACTCCTGTTTACCAACCGGACAGAGAAAGAAGTGAAAGAGTGGTTTGATCAGTTCAAGGACATGGATTTTGCCAGAGCTGGGAACAAAGCGACGTACGCAGTGGTACTGGATGCTGGGCCCCTGGAACAGTTCACTCACTCAATGGAACCGCAGTTAAGACAATTGGGGCTCCCCACTGCTCTGAAAAAAGGAGTCATCACGTTACTGTCAGACTACGAAGTATGTAAAGAGGGGGACGTATTAACCCCCGAACAAGCCAGGATTCTGAAGTTGTTCAGCTTCCAGATGGCTGAGTTTAAAGTCTCCATCAAATCCATTTGGACCGCGGAGACGGGCGAGTTCCAGAAGTTTGGGGATGAGACGGAGGAGAAGAGCGAAGAGGAAGATATGGATGAGGAAGAAGAGAATAACGATGCCTAG
Full Trace Sequence: cggaggagaagcttcaaccatgcccaagtctaagcgggacaagaaggtttccttaaccaaaacagccaagaaagggctggaggtgaagcagaatctcatagaagagctgcggaaatgtgtcgacacctacaagtacatctatgtgctctctgtggagaacatgagaaacaacaaactgaaggacgtccggaacgcatggaagcacagcaggttattcttcgggaagaacaaggtgatgatggtggcgctggggaaaggagtcagtgatgaatacaaggataacttgcacaagctgagcaagtgcctgaaaggcgaagtcggactcctgtttaccaaccggacagagaaagaagtgaaagagtggtttgatcagttcaaggacatggattttgccagagctgggaacaaagcgacgtacgcagtggtactggatgctgggcccctggaacagttcactcactcaatggaaccgcagttaagacaattggggctccccactgctctgaaaaaaggagtcatcacgttactgtcagactacgaagtatgtaaagagggggacgtattaacccccgaacaagccaggattctgaagttgttcagcttccagatggctgagtttaaagtctccatcaaatccatttggaccgcggagacgggcgagttccagaagtttggggatgagacggaggagaagagcgaagaggaagatatggatgaggaagaagagaataacgatgcctaggaacacaatctccgacccccccagcccaggggtccggttctggttcagattcaggacacttatgccgctccgggactgctgataccgacagccaatccaataacagaatgttcctgtgttttaacagatgacattttgccctaaaatgccttccagtgggcgtcgccctgcagtgactggcggtttgtgtgggttacggtcgcggtgccctcggcccgtttgacaccgggtttagcgctcactctgttccaaacacaatcagctgcattttaggaataaaatcatgtgatttggtaacagaacaagtttcagttcttgtgaattcccctctctgcttcttgttatttaaaggggatataaaccctgtcgcttattacacacaatatcaataaaaaatggaaaccaaaaaaaaaaaaaaaa
Translation: MPKSKRDKKVSLTKTAKKGLEVKQNLIEELRKCVDTYKYIYVLSVENMRNNKLKDVRNAWKHSRLFFGKNKVMMVALGKGVSDEYKDNLHKLSKCLKGEVGLLFTNRTEKEVKEWFDQFKDMDFARAGNKATYAVVLDAGPLEQFTHSMEPQLRQLGLPTALKKGVITLLSDYEVCKEGDVLTPEQARILKLFSFQMAEFKVSIKSIWTAETGEFQKFGDETEEKSEEEDMDEEEENNDA
Donor tissue: