ORFeome > nt5c1a – XORFeome 2.0

nt5c1a – XORFeome 2.0

General Information

Species: Xenopus tropicalis 5'-nucleotidase, cytosolic IA, mRNA (cDNA clone MGC:75654 IMAGE:5379664), complete cds
Gene Symbol: nt5c1a
Gene ID: 394700
ORF gb_acc: MG132786
ORF ID: 10106

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062488

Library Location

Plate ID: GDExt11002
Well Location: F01

EST Sequences

Clone: MGC:75654 IMAGE:5379664
Trimmed Sequence: ATGAGCGACATTGCCGCAGGGAATACCTCTGTCGCACCGACTTCACCGTCCAAACAGGAGGTGTCCAATGTAGTGCAAAGCGAAGATCCTAAGGACGCCAAGGCCTTCTATGACAAACTGGCCCCCAAGAAGAAGCCTAGGCTACCCAAGCCGCAGAATGCCATTACCATTGCCGTCTCCTCCAGGACCCTGTTTAATATGGTGGAGGAGAGGAAGATATACGAGCAGCTGGGAGTAGAGAAGTACGTGCAATATCAGCAGGACCATGAGACTGAGCCCCTGAAAACTGGGCCTGCCTTCCCCTTTGTAAAGGCTGTGGAAGAAGTTAATAACCAGCTCCGAGAGCTCTACCCTGACAGCGAGGAGCTGTTTGATATCGTGCTAATGACGAACAACCACGCCCAGGTTGGAGTGCGGCTCATAAACAGCATCAATCACTACGGCCTGAACATTGAGCGTTTCTGTCTGACTGGAGGCAAATCTCCGATTGGCTACCTTAAGGCCTATTTAACTAACCTGTACCTGTCGGCAGATTCAGAAAAGGTTCAGGAAGCCATTGCAGAAGGTATTGCAGCTGCCACCATGTTTATAGCAAAGAAGGACACAGTTCTGTCAGAGAAACAGCTAAGAGTAGCATTTGATGGCGATGCCGTTTTATTTTCTGATGAGTCAGAGCAAATTGTGAAAGAGCACGGCCTGGACACCTTTTTTGAACACGAGAAGGCGTTTGAGAACAAGCCACTTGCACAGGGTCCTTTGAAATGCTTCTTGGAAGCCTTGGGGAAGCTCCAAAGGAAGTTCCATGCCAAAGATGCACGTTTGAACTGCCCAATCAGAACCTACTTGGTGACTGCCAGAAGTGCTGCAAGCTCAGGGGCCAGAGCCCTTAAGACCTTGCGTAGTTGGGGTTTGGAGGTCGACGAAGCGCTCTTCCTTGCAGGTGCCCCTAAGGGCCCCATTCTGGAGAAGATACGCCCTCATCTTTTCTTTGATGACCAGATGTTTCACATAGAGGGAGCCCAGGACCTTGGTACCATTGCTGCACATGTACCTTATGGTATTGGCCAGAAGTACAACAAATCAACCCCAAAGGAGAGTAACAAGAAGTAA
Full Trace Sequence: cactgatagtatctgtacccagcccatctcctccttcctcaggtacgaactactactccggctccatcaggtcgactaaagggcaactgccccgccagccgcagcaacccaaaggtcccgtcccccgccagcaacgcccaggggagaagcatgagcgacattgccgcagggaatacctctgtcgcaccgacttcaccgtccaaacaggaggtgtccaatgtagtgcaaagcgaagatcctaaggacgccaaggccttctatgacaaactggcccccaagaagaagcctaggctacccaagccgcagaatgccattaccattgccgtctcctccaggaccctgtttaatatggtggaggagaggaagatatacgagcagctgggagtagagaagtacgtgcaatatcagcaggaccatgagactgagcccctgaaaactgggcctgccttcccctttgtaaaggctgtggaagaagttaataaccagctccgagagctctaccctgacagcgaggagctgtttgatatcgtgctaatgacgaacaaccacgcccaggttggagtgcggctcataaacagcatcaatcactacggcctgaacattgagcgtttctgtctgactggaggcaaatctccgattggctaccttaaggcctatttaactaacctgtacctgtcggcagattcagaaaaggttcaggaagccattgcagaaggtattgcagctgccaccatgtttatagcaaagaaggacacagttctgtcagagaaacagctaagagtagcatttgatggcgatgccgttttattttctgatgagtcagagcaaattgtgaaagagcacggcctggacaccttttttgaacacgagaaggcgtttgagaacaagccacttgcacagggtcctttgaaatgcttcttggaagccttggggaagctccaaaggaagttccatgccaaagatgcacgtttgaactgcccaatcagaacctacttggtgactgccagaagtgctgcaagctcaggggccagagcccttaagaccttgcgtagttggggtttggaggtcgacgaagcgctcttccttgcaggtgcccctaagggccccattctggagaagatacgccctcatcttttctttgatgaccagatgtttcacatagagggagcccaggaccttggtaccattgctgcacatgtaccttatggtattggccagaagtacaacaaatcaaccccaaaggagagtaacaagaagtaatgtgatggtgttaggagggtcgttctgctgtgacaacttataataggtttcatataggaatttcccccctgaatagcatttgatgctattttattgtggttgtaagtggccttcaggttatattaccctctatttcatgccatatcacttgcggttattgggatcagtattgctatgaagtttgagtcacaagcaatcataaaaatacctagatatgagctcaaacctatattgctaatcttctttgcacaatgacctcctcccttccttaacaacacaaaaaaaaaaaaaaa
Translation: MSDIAAGNTSVAPTSPSKQEVSNVVQSEDPKDAKAFYDKLAPKKKPRLPKPQNAITIAVSSRTLFNMVEERKIYEQLGVEKYVQYQQDHETEPLKTGPAFPFVKAVEEVNNQLRELYPDSEELFDIVLMTNNHAQVGVRLINSINHYGLNIERFCLTGGKSPIGYLKAYLTNLYLSADSEKVQEAIAEGIAAATMFIAKKDTVLSEKQLRVAFDGDAVLFSDESEQIVKEHGLDTFFEHEKAFENKPLAQGPLKCFLEALGKLQRKFHAKDARLNCPIRTYLVTARSAASSGARALKTLRSWGLEVDEALFLAGAPKGPILEKIRPHLFFDDQMFHIEGAQDLGTIAAHVPYGIGQKYNKSTPKESNKK
Donor tissue: tailbud