ORFeome > olig3 – XORFeome 2.0

olig3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis oligodendrocyte transcription factor 3, mRNA (cDNA clone MGC:89336 IMAGE:6987669), complete cds
Gene Symbol: olig3
Gene ID: 493553
ORF gb_acc: MG133793
ORF ID: 11365

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082516

Library Location

Plate ID: GDExt11013
Well Location: F03

EST Sequences

Clone: MGC:89336 IMAGE:6987669
Trimmed Sequence: ATGAATTCTGATTCCAGCTCCATGTCCAGCAGAGCCTCTTCGCCTGATATGGAGGACATGTATCTCAGGAGCCATCATCGCCCGGACAACAGGATGAGCTCTGTATCATCCACGCAGAACGACATGCTACAGAAGATGTCGGAAGAGATGCTCTCCAAGCATGGCTCTAGAGGGGAAGGGGAGAGTAGTAAGTACAAGATAAAGAAACAGCTCTCCGAACAGGACTTGCAGCAACTCAGACTAAAAATTAACGGCAGAGAACGCAAAAGGATGCATGACCTGAACCTTGCCATGGATGGACTCAGGGAAGTTATGCCCTATGCCCATGGACCATCAGTTAGAAAACTTTCAAAAATTGCTACTCTCCTGCTGGCACGAAACTATATACTGATGCTCACAAGTTCCCTAGAGGAAATGAAGCGCCTGGTGGGGGAGATCTATGGAGGGCACCACTCTGCTTTCCACTGTGGGACAGTTGGACATTCGGCTAATCACCCTGTGCACCCACCCAACGCTGCCCATCAGGTCCACCCAATTCTAGGCAGCTCTCTTTGCTCTAATACCCCCTCCAGCCTTTCAGCATCCTTGCCAGGTATTGGCACCATTAGACCTGCACACTCACTGCTTAAAACTCCTTCTACCCCTCCACTATCAATTGGCAGCGGATTTCAGCACTGGGCAGGACTCCCGTGCCCATGTACTATATGCCAGATGCCACCGCCACCCCAGCTTTCAGTTATGACCACCAGCATGTCCCGGATCTCAGCAGAAACCAAAGACTTGCTGAAATAA
Full Trace Sequence: tagagctctacttgtggtacctgccacagagtagctgacacaactggactcctcccagcaaaagtggggactcaagcttgttgcattcaccctgcactacagataagtgggatcagcgatcctgcattcccagaccatgaattctgattccagctccatgtccagcagagcctcttcgcctgatatggaggacatgtatctcaggagccatcatcgcccggacaacaggatgagctctgtatcatccacgcagaacgacatgctacagaagatgtcggaagagatgctctccaagcatggctctagaggggaaggggagagtagtaagtacaagataaagaaacagctctccgaacaggacttgcagcaactcagactaaaaattaacggcagagaacgcaaaaggatgcatgacctgaaccttgccatggatggactcagggaagttatgccctatgcccatggaccatcagttagaaaactttcaaaaattgctactctcctgctggcacgaaactatatactgatgctcacaagttccctagaggaaatgaagcgcctggtgggggagatctatggagggcaccactctgctttccactgtgggacagttggacattcggctaatcaccctgtgcacccacccaacgctgcccatcaggtccacccaattctaggcagctctctttgctctaataccccctccagcctttcagcatccttgccaggtattggcaccattagacctgcacactcactgcttaaaactccttctacccctccactatcaattggcagcggatttcagcactgggcaggactcccgtgcccatgtactatatgccagatgccaccgccaccccagctttcagttatgaccaccagcatgtcccggatctcagcagaaaccaaagacttgctgaaataacaacaagaagaggcgtcggtacaaagacttgcctccttaaactgcttttatacttattcagattaatgaaaaaaatatatatacagaattatagaaaaaaaatctatttgtggtgatgcaggaagactcagacaacaaatgtagtttgtatgcatgcttcttttatgttcacaaccattttccccattattctcatggtgttgtttgcgggggtagtgtcttataagaaatatgtaaaatattgaattaggtttgtccgtggttagcatatcattcggtatgttctgaggaatccatgcagaccaggttgttctcaaaccattttgcagagatatttttacaactgattttaattataagactggaaagaatacatgcatgcttagaagcgagtcttattaaaacgtgatcctgagtaccatacagttttccttgtaccaaggattttaattggggaattctttgaaattgttttgtgtgtgtatatatgactttgtaaaacttggtgggaacagtgttgtaaaacctccacagtaacaaaattaattcaatgctggtgtccagtgtggctataattctcttactgtgaacctcaaaatccaacatcacccttttattgcagcaatgcagagaaaacttcaggtttgggagagcgctttagcactaaaatgggtaaaggattcgtgttcatttgtcttaaagttgattttcgttcgccttttatagtttttataatataatttagtctctggacatcatggacattcacttgaacttattttgttaagacagatacattgcttgcctttattttttatattttcttgataactattgatatatttattacagaacagctttcttggaaggaatttaaataaaagatacagtgaaaatgaaaaaaaaaaaaaaaaaaaaa
Translation: MNSDSSSMSSRASSPDMEDMYLRSHHRPDNRMSSVSSTQNDMLQKMSEEMLSKHGSRGEGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSANHPVHPPNAAHQVHPILGSSLCSNTPSSLSASLPGIGTIRPAHSLLKTPSTPPLSIGSGFQHWAGLPCPCTICQMPPPPQLSVMTTSMSRISAETKDLLK
Donor tissue: gastrula