ORFeome > pafah1b3 – XORFeome 2.0

pafah1b3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, mRNA (cDNA clone MGC:89219 IMAGE:7017499), complete cds
Gene Symbol: pafah1b3
Gene ID: 448360
ORF gb_acc: MG134164
ORF ID: 11798

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075442

Library Location

Plate ID: GDExt11017
Well Location: C11

EST Sequences

Clone: MGC:89219 IMAGE:7017499
Trimmed Sequence: ATGAGTGAAGAAGAGCAGAACCCAGCTGCCGTTCCCACTCCTATGTCTGACATCCAGGGTGATGGGCGCTGGATGTCTATGCACAATCATTTTGTGTCCAGTAGCAAAGACAAGGAGCCTGAAGTAGTGTTCATAGGAGACTCCAATGTCCAGATTATGCACCAGTTTGAGGTCTGGAGGGAGCTTTTCTCCCCACTCCATGCTTTGAATTTTGGTGGGCTAAGTGATGGCACACAGCATGTTTTGTGGAGACTGGAGAACGGAGAACTTGATCACGTCAAACCCAAGATCATCGTTCTGTGGGTTGGCACTTATAACCAAGGGCACAGCGCTGAACAGATCGCAGGAGGCATTCTTGCTATTGTCCGGTGTATTTATCAGAGGCAACCTCAAGCCAAAGTCATTGTGATGGCCTTGCTCCCACGTGGGAAGAACCCAAATCCGTTACGGAACAGGAATCTACAAGTGAACAAATTACTGGAGGAAACACTGCCCTCACTGCCTAATGCATTCCTGTTAGATGCTGACCCGGGCTTCGTGCATTCCGACGGCACCATCAGTCACCATGACATGTATGATTATCTGCACTTGAGCCGGCATGGATATGCACGAGTGTGCCCAAATTTGCACCGTACACTGCTGCAGTTCCTGGAAGGCAGAGACACCCCCTCTAGTCAGTAA
Full Trace Sequence: gccccccttcccgtcagggtggaatggtgcaggccaggagggaggattctttcattggagaaagagcaagtgaaaagggagtgcaggatgagtgaagaagagcagaacccagctgccgttcccactcctatgtctgacatccagggtgatgggcgctggatgtctatgcacaatcattttgtgtccagtagcaaagacaaggagcctgaagtagtgttcataggagactccaatgtccagattatgcaccagtttgaggtctggagggagcttttctccccactccatgctttgaattttggtgggctaagtgatggcacacagcatgttttgtggagactggagaacggagaacttgatcacgtcaaacccaagatcatcgttctgtgggttggcacttataaccaagggcacagcgctgaacagatcgcaggaggcattcttgctattgtccggtgtatttatcagaggcaacctcaagccaaagtcattgtgatggccttgctcccacgtgggaagaacccaaatccgttacggaacaggaatctacaagtgaacaaattactggaggaaacactgccctcactgcctaatgcattcctgttagatgctgacccgggcttcgtgcattccgacggcaccatcagtcaccatgacatgtatgattatctgcacttgagccggcatggatatgcacgagtgtgcccaaatttgcaccgtacactgctgcagttcctggaaggcagagacaccccctctagtcagtaagcactaaccagcaagggccacagtcttgacaaaaagtctggagtaatgaatttggacatattgtcagttccggtgaggcagaaggcacctgcagcataagagctacctggaatggcggattagtggatagtaatttccctctcgatcaagagtagtattgaaccaactaactgctcagggcaactgccctccctgcccagatcacatgcataactgcccctagggagggcagcacagactctcttttttcctttcttggcgtgtggttttgcagcatctcattgttttattccccttgtactgtgtcatatttgtgtatttgtatgctaagtattatgttctctgtctgccatcagcctccaggatgaccaaatgtacctcagtacccccaaaccaacagatcctgtctgctctatcacttacatacagagccatataataaacctgttttgactttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSEEEQNPAAVPTPMSDIQGDGRWMSMHNHFVSSSKDKEPEVVFIGDSNVQIMHQFEVWRELFSPLHALNFGGLSDGTQHVLWRLENGELDHVKPKIIVLWVGTYNQGHSAEQIAGGILAIVRCIYQRQPQAKVIVMALLPRGKNPNPLRNRNLQVNKLLEETLPSLPNAFLLDADPGFVHSDGTISHHDMYDYLHLSRHGYARVCPNLHRTLLQFLEGRDTPSSQ
Donor tissue: