ORFeome > pgm1 – XORFeome 2.0

pgm1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis phosphoglucomutase 1, mRNA (cDNA clone MGC:76160 IMAGE:5335414), complete cds
Gene Symbol: pgm1
Gene ID: 407960
ORF gb_acc: MG133433
ORF ID: 10949

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC068033

Library Location

Plate ID: GDExt11009
Well Location: C09

EST Sequences

Clone: MGC:76160 IMAGE:5335414
Trimmed Sequence: ATGGTCAAAATCCAAACAGTCAAAACCAAACCTTATACCGACCAGAAGCCGGGCACCAGCGGCCTCAGGAAGCGGGTCACTGTGTTTCAGACCAACGCTAACTATGCTGAGAATTTCATTCAAAGTATCATCTCCTGCACGGACCCTGCAGAGAGGCAGGATGGGGTCCTGGTGGTGGGAGGAGATGGCAGGTTTTACATGAAGGAAGCGATACAACTCATTATCCAGATCGCTGCTGCTAACGGGATTGGGCGCTTAGTTATTGGACAGAATGGTATTCTCTCTACACCGGCAGTATCCTGCATTATCAGAAAAATTAAAGCCATTGGGGGCATTATTCTGACCGCTAGCCATAATCCAGGGGGCCCAAATGGAGATTTTGGCATCAAGTTTAATACTTCGAATGGAGGTCCAGCACCTGAAGCCATTACTGATAAGATTTTCCAGCTCAGCAAAACCATAGAAGAATATGCTATTTGCCCTGATCTTAAAGTAGATTTGACTACTATTGGAAAACAACAGTTTGACTTGGAGAACAAATTCAAACCATTTACTGTGGAGATTGTAGACTCGGTGGAAGCCTATGCAAACATGCTGAGAAATATATTTGACTTCAGTGCCTTAAAAGAACTACTTTCTGGACAGAACAGACTTAAAATTCGAATTGATGCAATGCATGGAGTTGTTGGCCCTTATGTGAAAAAGATCTTGTGCGAAGAATTGGGAGCTCCTGCCAATTCTGCAGTCAACTGCATACCGCTAGAGGATTTTGGTGGTCACCATCCCGACCCAAATTTGACATATGCTTCTGAGTTAGTGGACACCATGAAGACTGGGGAACACGACTTTGGAGCTGCCTTTGATGGAGATGGGGATCGCAACATGATTCTTGGAAAAAATGGCTTCTTTGTTAACCCTTCTGACTCTGTTGCTGTGATAGCCGCCAACATTTTTAGTATTCCTTACTTCCAACACACCGGTGTTCGTGGCTTTGCAAGGAGTATGCCAACAAGTGGTGCCCTTGACAGAGTGGCAAAAGCTACAAAGATTGCTTTATATGAAACTCCAACTGGGTGGAAATTCTTTGGAAATTTAATGGATGCTAACAAGCTGTCCCTGTGCGGAGAGGAAAGCTTTGGAACTGGCTCTGACCATATTCGAGAAAAGGATGGACTTTGGGCAGTTCTCGCATGGCTATCAATCATTGCCACACGCAAACAGAGTGTGGAGGAAATTCTAAAAGATCACTGGCAGAAGTATGGTCGTAATTTTTTCACACGATATGATTATGAAGAGGTTGATTCTGAAGGAGCTAACAAGATGATGAAAGACCTTGAAACATTGATGTTTGATCGCGCATTCATTGGTCAGCAGCTTTCTGTTGGGGATAAAGTTTATACTGTTGAAAAAGCAGATAACTTTGAGTATAGTGACCCTGTTGATGGAAGTATTTCAAGAAACCAGGGATTAAGGCTTATTTTTGCTGATGGATCTCGAGTCATCTTTAGGCTTAGTGGTACAGGCAGCGCTGGAGCTACCATTAGATTATATATTGACAGCTATGAGAAGGATTTACAGAAAATATATGAAGACCCTCAGGTTATGCTGGGCCCTCTTATTACTATTGCACTTAAGATCTCAAAGTTACAGGAAAGAACAGGTCGCTCAGCTCCTACTGTTATCACATAA
Full Trace Sequence: ctcgaactcagcctgcacaatggtcaaaatccaaacagtcaaaaccaaaccttataccgaccagaagccgggcaccagcggcctcaggaagcgggtcactgtgtttcagaccaacgctaactatgctgagaatttcattcaaagtatcatctcctgcacggaccctgcagagaggcaggatggggtcctggtggtgggaggagatggcaggttttacatgaaggaagcgatacaactcattatccagatcgctgctgctaacgggattgggcgcttagttattggacagaatggtattctctctacaccggcagtatcctgcattatcagaaaaattaaagccattgggggcattattctgaccgctagccataatccagggggcccaaatggagattttggcatcaagtttaatacttcgaatggaggtccagcacctgaagccattactgataagattttccagctcagcaaaaccatagaagaatatgctatttgccctgatcttaaagtagatttgactactattggaaaacaacagtttgacttggagaacaaattcaaaccatttactgtggagattgtagactcggtggaagcctatgcaaacatgctgagaaatatatttgacttcagtgccttaaaagaactactttctggacagaacagacttaaaattcgaattgatgcaatgcatggagttgttggcccttatgtgaaaaagatcttgtgcgaagaattgggagctcctgccaattctgcagtcaactgcataccgctagaggattttggtggtcaccatcccgacccaaatttgacatatgcttctgagttagtggacaccatgaagactggggaacacgactttggagctgcctttgatggagatggggatcgcaacatgattcttggaaaaaatggcttctttgttaacccttctgactctgttgctgtgatagccgccaacatttttagtattccttacttccaacacaccggtgttcgtggctttgcaaggagtatgccaacaagtggtgcccttgacagagtggcaaaagctacaaagattgctttatatgaaactccaactgggtggaaattctttggaaatttaatggatgctaacaagctgtccctgtgcggagaggaaagctttggaactggctctgaccatattcgagaaaaggatggactttgggcagttctcgcatggctatcaatcattgccacacgcaaacagagtgtggaggaaattctaaaagatcactggcagaagtatggtcgtaattttttcacacgatatgattatgaagaggttgattctgaaggagctaacaagatgatgaaagaccttgaaacattgatgtttgatcgcgcattcattggtcagcagctttctgttggggataaagtttatactgttgaaaaagcagataactttgagtatagtgaccctgttgatggaagtatttcaagaaaccagggattaaggcttatttttgctgatggatctcgagtcatctttaggcttagtggtacaggcagcgctggagctaccattagattatatattgacagctatgagaaggatttacagaaaatatatgaagaccctcaggttatgctgggccctcttattactattgcacttaagatctcaaagttacaggaaagaacaggtcgctcagctcctactgttatcacataaagtggtataagacatccagtaaacttactggacttccatagcgatccatcccatacctgttccctcagtcttccatctctgtgccgtagtgtgtttattgctattcatgttccagtgacctaagcagataaaagtacagaaattttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVKIQTVKTKPYTDQKPGTSGLRKRVTVFQTNANYAENFIQSIISCTDPAERQDGVLVVGGDGRFYMKEAIQLIIQIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNTSNGGPAPEAITDKIFQLSKTIEEYAICPDLKVDLTTIGKQQFDLENKFKPFTVEIVDSVEAYANMLRNIFDFSALKELLSGQNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNCIPLEDFGGHHPDPNLTYASELVDTMKTGEHDFGAAFDGDGDRNMILGKNGFFVNPSDSVAVIAANIFSIPYFQHTGVRGFARSMPTSGALDRVAKATKIALYETPTGWKFFGNLMDANKLSLCGEESFGTGSDHIREKDGLWAVLAWLSIIATRKQSVEEILKDHWQKYGRNFFTRYDYEEVDSEGANKMMKDLETLMFDRAFIGQQLSVGDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFADGSRVIFRLSGTGSAGATIRLYIDSYEKDLQKIYEDPQVMLGPLITIALKISKLQERTGRSAPTVIT
Donor tissue: tailbud