ORFeome > phb – XORFeome 2.0

phb – XORFeome 2.0

General Information

Species: Xenopus tropicalis prohibitin, mRNA (cDNA clone MGC:75944 IMAGE:5383940), complete cds
Gene Symbol: phb
Gene ID: 394635
ORF gb_acc: MG133022
ORF ID: 10411

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061380

Library Location

Plate ID: GDExt11004
Well Location: C10

EST Sequences

Clone: MGC:75944 IMAGE:5383940
Trimmed Sequence: ATGGCAGCACGACTGTTTGAGACTATTGGGAAACTTGGCCTAGGACTGGCTGTCGCTGGAGGGGTTGTGAACTCTGCACTATATAATGTGGATGCTGGACACCAGGCAGTCATCTTTGATAGGTTCCGAGGAGTACAGGAAACAGTAGTGGGCGAGGGAACCCATTTCCTTATTCCTTGGGTCCAGAAACCCATCATTTTCGACTGTCGCTCACGTCCTCGCAACGTACCTGTTGTTACAGGGAGCAAAGATCTACAGAACGTCAACATTACACTGCGTATCCTTTTCCGGCCAATGGGTAATCAGCTGCCGCGAATCTTCACCAGTATTGGAGAAGATTATGATGAGAGAGTCCTGCCCTCCATTACTACTGAGATCCTAAAATCTGTAGTGGCCCGGTTCGATGCAGGGGAGCTAATCACACAGAGAGAGCTGGTGTCCAGGCAGGTGAGCGAGGATCTCATGGAGAGAGCAGCCACCTTCGGCCTCATCCTGGATGACGTGTCACTGACACATCTGACCTTTGGCAAGGAGTTCACAGAGGCCGTAGAAGCCAAACAGGTGGCCCAGCAGGAAGCGGAGCGTGCCAGGTTCATTGTGGAGAAGGCTGAGCAGCAAAAGAAAGCTGCAGTGATTTCTGCAGAAGGGGACTCCAAGGCAGCAGAGCTCATTGCGACGTCACTGGCGGATGCAGGAGATGGGCTTATCGAGCTGCGCAAACTGGAGGCCGCAGAGGACATCGCGTACCAGCTGTCTCGAGCTCGTAATGTCACCTACCTTCCCTCAGGACAGTCAACATTATTACAGCTACCACAGTAA
Full Trace Sequence: cggaagcgtgtttcatgtggaggtcagaacgtaaggagttttgatttaacccgcaggaccaatggcagcacgactgtttgagactattgggaaacttggcctaggactggctgtcgctggaggggttgtgaactctgcactatataatgtggatgctggacaccaggcagtcatctttgataggttccgaggagtacaggaaacagtagtgggcgagggaacccatttccttattccttgggtccagaaacccatcattttcgactgtcgctcacgtcctcgcaacgtacctgttgttacagggagcaaagatctacagaacgtcaacattacactgcgtatccttttccggccaatgggtaatcagctgccgcgaatcttcaccagtattggagaagattatgatgagagagtcctgccctccattactactgagatcctaaaatctgtagtggcccggttcgatgcaggggagctaatcacacagagagagctggtgtccaggcaggtgagcgaggatctcatggagagagcagccaccttcggcctcatcctggatgacgtgtcactgacacatctgacctttggcaaggagttcacagaggccgtagaagccaaacaggtggcccagcaggaagcggagcgtgccaggttcattgtggagaaggctgagcagcaaaagaaagctgcagtgatttctgcagaaggggactccaaggcagcagagctcattgcgacgtcactggcggatgcaggagatgggcttatcgagctgcgcaaactggaggccgcagaggacatcgcgtaccagctgtctcgagctcgtaatgtcacctaccttccctcaggacagtcaacattattacagctaccacagtaattggatgatgtgttgtcatgccatttatttttttttacgtctgacccctacataggtctttgttaattggccaatttcccttgggaaatgttacagaagattgtgtatgaaggtgaatctcctacagagcccacataataccctacatgaaatggactttagccacagaactgtttgaatcctgccaatatatttctgaatttgaattgaatataattgtattttcaatggagggcataatacatttttggttgaagcacttgtttatgtctaaacctaaaatctggccttctgtcactaacaataaaagttatccctcagaggatatttcaataatgaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAARLFETIGKLGLGLAVAGGVVNSALYNVDAGHQAVIFDRFRGVQETVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVVTGSKDLQNVNITLRILFRPMGNQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSEDLMERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFIVEKAEQQKKAAVISAEGDSKAAELIATSLADAGDGLIELRKLEAAEDIAYQLSRARNVTYLPSGQSTLLQLPQ
Donor tissue: neurula