ORFeome > pin1 – XORFeome 2.0

pin1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis peptidylprolyl cis/trans isomerase, NIMA-interacting 1, mRNA (cDNA clone MGC:89352 IMAGE:6988033), complete cds
Gene Symbol: pin1
Gene ID: 493472
ORF gb_acc: MG133905
ORF ID: 11498

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC081312

Library Location

Plate ID: GDExt11014
Well Location: B05

EST Sequences

Clone: MGC:89352 IMAGE:6988033
Trimmed Sequence: ATGGCGGACGAGGAGAAGCTACCGCCCGGGTGGGAGAAGCGCATGAGTCGAAGCTCGGGGCGTGTATATTATTTCAATCACATGACCAATGCCAGCCAATGGGAAAGGCCCACTACTGGTGGGAAAAATGGCCAGGGGGAGCCAGGAAAAGTGAGATGCTCTCACCTACTCGTGAAGCACAATCAGTCAAGGCGTCCTTCATCATGGAGGCAGGACAGGATCACTCGCACCAAGGACGAGGCACTGGAGCACATTAATGGCTACATCCAGAAGATAAAATCGGGGGATGAGGATTTTGAATCTCTTGCTTCTCGGTTCAGTGACTGCAGCTCAGCTAAGGCTGGAGGGGATCTGGGCAGCTTTGGGAGAGGTGCAATGCAGAAGCCCTTTGAAGATGCATCTTTCGCTCTGAGGCCTGGGGAGATGAGTGGCCCCGTCTTCACAGACTCCGGCATTCACATTATCCTCCGCACTGAGTGA
Full Trace Sequence: gacggagtggtttgtgtaggcggggcttggcctgacgcaggagggaaagatggcggacgaggagaagctaccgcccgggtgggagaagcgcatgagtcgaagctcggggcgtgtatattatttcaatcacatgaccaatgccagccaatgggaaaggcccactactggtgggaaaaatggccagggggagccaggaaaagtgagatgctctcacctactcgtgaagcacaatcagtcaaggcgtccttcatcatggaggcaggacaggatcactcgcaccaaggacgaggcactggagcacattaatggctacatccagaagataaaatcgggggatgaggattttgaatctcttgcttctcggttcagtgactgcagctcagctaaggctggaggggatctgggcagctttgggagaggtgcaatgcagaagccctttgaagatgcatctttcgctctgaggcctggggagatgagtggccccgtcttcacagactccggcattcacattatcctccgcactgagtgaatccacttttataatgggaactcttgctgctttcagggagggacgaaagggtttcccagtgagccaagggaatagatgtggggggctaggtaagggttagggtagtccagaaaaatacagaaattggcccagttctgctcagtgggttcaatcagttattggctgtttaagcatcatcatttatggaagtttgcgcattgttagcaggggatgtgcatgaagggcttggggctatttctctcatttcctctaattcccacatcagagtattagctatacaattagatcttgcctcggaacatttctgatccatctgcattctgtttctagctcctgtagtcatgtgaatggaatagcatgagaatctgaaggccacactatcctgtactaatgaacttgctcagttaggcgcagtggccaagaggcagtatatgcttttgtttatgtgagccctttccctatagtctatgtagtctctccctgggaaggactaataactcagtctctttccctcccagtgcaagaatggatattattatttacccacagggacctctctttccttataaaatgacctcatgtaaaagtaaatacatacactaggctcatatagaacataggtgtacatttgcccatagctaggttgtggctgtatagtaagggttttatatgggggttacctatttaatttagcatattaatagctcatcttacgcgacagaacaaaacagcttcatctgctttcattgtaatgagcgagcatgtcccttcagtcaataggacagaggctgtgacactgcggagaggtacatctcggcaatcatttaccagtgggagcacccaagctgaatttgctgcctgcacccacctcagctggcacagaccagattcctttccccacgtaatgcttatacctcatcttatgttgtaggcatcatttctgctcagtgctattggaataattctgctgtttttggctgttaaacctctttctccatccaagcaaaggaagtcacggtgtcaacaatatttggcaagtgctttttgtacatgaccagctgcttagggcaactgtattttatcttgttatgctgcatctgttctctaaatgaagattaatttaatatcttgattcacatttctatgactgacagtgggatatttgcttgcattatagtatttttgagcctaaaaaaaaaaaaaaaa
Translation: MADEEKLPPGWEKRMSRSSGRVYYFNHMTNASQWERPTTGGKNGQGEPGKVRCSHLLVKHNQSRRPSSWRQDRITRTKDEALEHINGYIQKIKSGDEDFESLASRFSDCSSAKAGGDLGSFGRGAMQKPFEDASFALRPGEMSGPVFTDSGIHIILRTE
Donor tissue: gastrula