ORFeome > ppap2c – XORFeome 2.0

ppap2c – XORFeome 2.0

General Information

Species: Xenopus tropicalis phosphatidic acid phosphatase type 2C, mRNA (cDNA clone MGC:75849 IMAGE:5382670), complete cds
Gene Symbol: ppap2c
Gene ID: 394722
ORF gb_acc: MG133045
ORF ID: 10446

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061332

Library Location

Plate ID: GDExt11004
Well Location: F09

EST Sequences

Clone: MGC:75849 IMAGE:5382670
Trimmed Sequence: ATGGTGCCTGACCGGAGGAACGTTTACGTAGTGCTGGACGTACTATGTGTGTCTGTCGCGTCCTTACCATTTATTATTATGTCACTGGTGAACTCTCCATACAAACGGGGATTTTATTGCAATGATGAGTCAATCAGGTACCCATACCGTGAGGACACAATTACTAATGGACTGATGGCCGGAGTCACTATTTCCTGCACCGTAATCATTATATCCTCTGGTGAGATGTACATGGTGTTTTCCAAGAGATTGTACTCCCGCTCTGAGTGTAACAATTATATTGCTGCGCTGTACAAAGTTGTGGGGACTTATCTTTTTGGGGCTGCTATAAGCCAGTCTTTAACAGATCTTGCAAAGTACATGATTGGACGTCCCAGACCAAACTTCATTGCTGTGTGTGACCCAGACTGGTCCACTGTCAATTGCTCAGGATATGTAACAGATTTTACCTGTCGTGGTAATTACGCCAATGTGACAGATTCCAGACTCTCCTTTTATTCGGGGCACTCATCCTTTGGAATGTACTGCATGTTATTCCTGTCTCTGTATGTCCAGGCTCGATTGTGTGGTAAGTGGGCTCGACTCCTGCGTCCCACCATACAATTTTTCTTGTTGTCGTTTGCTCTTTATGTGGGATACACACGTGTCTCTGATTACAAGCACCACTGGAGTGACGTTCTTGTGGGACTCCTGCAGGGAGCAATCGTGGCTGCTTTCACTGTGCGTTATGTCTCAGATTTCTTCAAGATCAGACCTCCACTTCAATGTACCAAAGACCCTCTTGAGAGCAAACCAAGTCTGCAGCTTAGTGAATCGGACCAGAATCATTTTGGATACCTTGGAGGATCCTGA
Full Trace Sequence: cggagcgggtggggggaggatggtgcctgaccggaggaacgtttacgtagtgctggacgtactatgtgtgtctgtcgcgtccttaccatttattattatgtcactggtgaactctccatacaaacggggattttattgcaatgatgagtcaatcaggtacccataccgtgaggacacaattactaatggactgatggccggagtcactatttcctgcaccgtaatcattatatcctctggtgagatgtacatggtgttttccaagagattgtactcccgctctgagtgtaacaattatattgctgcgctgtacaaagttgtggggacttatctttttggggctgctataagccagtctttaacagatcttgcaaagtacatgattggacgtcccagaccaaacttcattgctgtgtgtgacccagactggtccactgtcaattgctcaggatatgtaacagattttacctgtcgtggtaattacgccaatgtgacagattccagactctccttttattcggggcactcatcctttggaatgtactgcatgttattcctgtctctgtatgtccaggctcgattgtgtggtaagtgggctcgactcctgcgtcccaccatacaatttttcttgttgtcgtttgctctttatgtgggatacacacgtgtctctgattacaagcaccactggagtgacgttcttgtgggactcctgcagggagcaatcgtggctgctttcactgtgcgttatgtctcagatttcttcaagatcagacctccacttcaatgtaccaaagaccctcttgagagcaaaccaagtctgcagcttagtgaatcggaccagaatcattttggataccttggaggatcctgagacctttgtcaatctacatctatctctgacctgcaccatccacctttttgaggctatataaagcttgtggtctctgcttgggcagctcatggactgaatgaacttgtttctaccggtagaaaaatgttcatatttttcagatcttacaatttaatttttattttacagcacaaattaccaaagtaattttttaaaactctttgcttcttttgttgtcctgtcggtgtgactgtctacacatactgtgtatatgttcagatttttgtaccggctgtgagtgattgtgtcagtctgtgggtgggatttgtgtgcatgaatgttcttgactgactgaattacagtagccaggatcatagtgccagcctgtggttggcattgtgtgggccttttgctagaaggagaggccagtacttgcagcctgagtgctttactgcaagaagcagtttgacctccctgtcctaattttacatgagatttgccctattaccactttaattgagtatctatttacctgtttgtctgtgtcctgcttcctaaccactgctcaccacctcttggttttcagggggttaaaaggaggtcctttttggaactaccacatgtgccttaatgggagagtataggatgagcacctcccaaatattccttgtatatagtgattcaaaaggttttactgtgtgtgtaaataacactcttgagtctgtgtgcaattaacagttttctcctgcatcatatggcattcacatggaataacctcttctgtgttaccagcttttgccacatgtatggacctgtctacttcaatccaaaataataaaaaaatgaaattcagtatgctttgtgccttcaacctagcacatgacctgctcactttaaaacacctgtagcctcctctttaatggtttcttccttttctgcaccttttttttgtggccattaattgcagtgggcctagaataaaaagcaggtcaccaactccattattttctcactgtattgtgttagtgacactaagagaatcatttttttagagaacatgttctctgccaatacacagaccttagaggatcttgtctaaatacagcttctgtaattaatgcttttttattgtataatataagaataaactgcagtggcagtggggcaatacagtacccacttccatttctctcactaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVPDRRNVYVVLDVLCVSVASLPFIIMSLVNSPYKRGFYCNDESIRYPYREDTITNGLMAGVTISCTVIIISSGEMYMVFSKRLYSRSECNNYIAALYKVVGTYLFGAAISQSLTDLAKYMIGRPRPNFIAVCDPDWSTVNCSGYVTDFTCRGNYANVTDSRLSFYSGHSSFGMYCMLFLSLYVQARLCGKWARLLRPTIQFFLLSFALYVGYTRVSDYKHHWSDVLVGLLQGAIVAAFTVRYVSDFFKIRPPLQCTKDPLESKPSLQLSESDQNHFGYLGGS
Donor tissue: neurula