ORFeome > ppp1cc – XORFeome 2.0

ppp1cc – XORFeome 2.0

General Information

Species: Xenopus tropicalis protein phosphatase 1, catalytic subunit, gamma isoform, mRNA (cDNA clone MGC:69216 IMAGE:5307610), complete cds
Gene Symbol: ppp1cc
Gene ID: 407879
ORF gb_acc:
ORF ID: 10724

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067911

Library Location

Plate ID: GDExt11007
Well Location: E02

EST Sequences

Clone: MGC:69216 IMAGE:5307610
Trimmed Sequence: ATGGCAGATGTTGACAAGCTTAACATCGACAGCATCATACAGCGACTGTTAGAAGTTAGAGGATCAAAACCGGGAAAAAATGTTCAGCTTCAAGAGAATGAGATTCGAGGGCTCTGTCTGAAGTCTCGGGAAATCTTCCTCAGTCAGCCAATCTTGCTTGAGCTTGAAGCTCCTCTTAAAATATGTGGCGATATTCATGGCCAGTACTATGACTTACTGCGATTATTTGAATATGGTGGTTTCCCACCTGAAAGCAACTACCTGTTCCTAGGAGACTATGTGGACAGAGGGAAGCAGTCTTTAGAAACGATCTGTCTTCTTTTGGCATATAAAATCAAATATCCAGAGAACTTCTTCCTCCTCAGAGGCAATCATGAATGTGCCAGCATTAACAGAATCTATGGCTTTTATGATGAGTGTAAAAGAAGATATAATATAAAGTTATGGAAAACATTCACAGATTGCTTTAATTGTTTGCCAATAGCTGCTATAGTTGACGAGAAGATATTTTGCTGTCATGGAGGTTTGTCTCCAGACCTTCAGTCGATGGAGCAGATCCGACGAATTATGCGTCCTACTGACGTTCCAGACCAGGGTCTTCTGTGTGACTTACTTTGGTCTGATCCTGACAAAGATGTCCTAGGGTGGGGTGAAAATGACAGAGGTGTATCTTTTACTTTTGGAGCTGAAGTGGTTGCAAAATTTCTACACAAACATGATCTGGATCTCATTTGCCGAGCTCATCAGGTGGTTGAAGATGGGTATGAATTTTTTGCCAAGAGACAACTGGTTACTTTGTTCTCAGCCCCAAACTATTGTGGAGAATTTGATAATGCTGGAGCAATGATGAGTGTAGATGAAACGTTAATGTGTTCCTTCCAGATCCTAAAACCTGCAGAGAAAAAGAAGCCTAATGCAAGCAGACCTGTAACGCCACCACGAGGCATGATCACAAAACAAGCAAAGAAATAA
Full Trace Sequence: gtacgtttgggcttctgtttttattgcgacagtttactgggtccgccatttagacttccggagcaatggcagatgttgacaagcttaacatcgacagcatcatacagcgactgttagaagttagaggatcaaaaccgggaaaaaatgttcagcttcaagagaatgagattcgagggctctgtctgaagtctcgggaaatcttcctcagtcagccaatcttgcttgagcttgaagctcctcttaaaatatgtggcgatattcatggccagtactatgacttactgcgattatttgaatatggtggtttcccacctgaaagcaactacctgttcctaggagactatgtggacagagggaagcagtctttagaaacgatctgtcttcttttggcatataaaatcaaatatccagagaacttcttcctcctcagaggcaatcatgaatgtgccagcattaacagaatctatggcttttatgatgagtgtaaaagaagatataatataaagttatggaaaacattcacagattgctttaattgtttgccaatagctgctatagttgacgagaagatattttgctgtcatggaggtttgtctccagaccttcagtcgatggagcagatccgacgaattatgcgtcctactgacgttccagaccagggtcttctgtgtgacttactttggtctgatcctgacaaagatgtcctagggtggggtgaaaatgacagaggtgtatcttttacttttggagctgaagtggttgcaaaatttctacacaaacatgatctggatctcatttgccgagctcatcaggtggttgaagatgggtatgaattttttgccaagagacaactggttactttgttctcagccccaaactattgtggagaatttgataatgctggagcaatgatgagtgtagatgaaacgttaatgtgttccttccagatcctaaaacctgcagagaaaaagaagcctaatgcaagcagacctgtaacgccaccacgaggcatgatcacaaaacaagcaaagaaataaaagctttttctttttggacttgtattatagtatataatctcatttttttaattgtgtaatgtgtcctggttaggtccatctagatgtttgtggctttttttctgtttcctttttaatgaattgtatttgctacagcagtcacttctttctcctcaacgcctttttctattggaaagcacataggccatgttatctcctgaattgcgtcccttatgccagtgttactgtacactccaaatctgtatgcttcattatttccctttatacagtctatctacatacattgtaaaggctttataaaatacctaaagagggcactaatgggctagtgagagaatggcatggctatcattcgcatactgtttattcaaaccactgtgaacatttttttacttttgttttaaagggatttttttttgtcatgttctttgtatggttgtcaatattagatttccccttgaccttgccagcatcactgactcgatgtatatttaattaaagcacatttcccgtactgtatactttaaataaaagccattattttaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNASRPVTPPRGMITKQAKK
Donor tissue: gastrula