ORFeome > ppp2ca – XORFeome 2.0

ppp2ca – XORFeome 2.0

General Information

Species: Xenopus tropicalis protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, mRNA (cDNA clone MGC:75638 IMAGE:5379510), complete cds
Gene Symbol: ppp2ca
Gene ID: 394888
ORF gb_acc: MG132873
ORF ID: 10233

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064168

Library Location

Plate ID: GDExt11003
Well Location: E02

EST Sequences

Clone: MGC:75638 IMAGE:5379510
Trimmed Sequence: ATGGATGAAAAGGCGTTCACGAAGGAGTTGGATCAGTGGATCGAGCAGCTGAATGAGTGCAAGCAGCTATCGGAGAACCAGGTCAAGACTCTGTGCGAGAAGGCAAAAGAAATCTTAACAAAAGAATCAAATGTCCAGGAAGTTCGGTGCCCAGTCACAGTATGTGGAGATGTACACGGACAATTTCACGATCTTATGGAACTGTTCAGAATTGGAGGCAAATCACCAGATACAAATTATTTGTTTATGGGAGACTATGTTGACAGAGGATATTACTCTGTTGAAACTGTAACGCTGCTTGTTGCACTTAAGGTTCGCTATCGGGAACGCATCACAATCCTCCGAGGAAATCATGAAAGTAGACAAATCACACAAGTATATGGATTTTATGATGAATGCTTAAGGAAATATGGAAATGCAAATGTCTGGAAGTATTTCACTGACCTTTTTGACTACCTCCCCCTGACTGCACTGGTAGATGGTCAGATCTTTTGTTTGCACGGAGGACTGTCTCCTTCAATAGATACACTTGATCATATACGGGCCCTTGATCGCCTTCAAGAAGTTCCACATGAGGGTCCAATGTGTGACTTACTTTGGTCTGACCCAGATGATCGTGGTGGCTGGGGCATATCACCTCGAGGTGCAGGTTATACATTTGGACAGGATATATCTGAAACATTCAACCATGCTAATGGCCTTACTTTGGTTTCAAGAGCCCATCAGCTAGTGATGGAAGGATACAATTGGTGCCATGATCGGAACGTAGTAACCATTTTTAGTGCTCCAAATTATTGTTACCGCTGTGGCAACCAAGCTGCAATAATGGAACTTGACGACACACTAAAATATTCATTCTTGCAGTTTGACCCAGCACCACGCAGGGGAGAGCCACATGTGACCCGTCGCACACCCGACTACTTCCTGTAA
Full Trace Sequence: gagccgtagctgcaaaattacagcggactgtctgataacgttatttctttattacctctactagctctgtacctcttacgaggcgctttgaagccctctggactgtgtccgtttagatactgtcgcctgagatcccggcactcccctgggttccgtattttattcaactgacggtccccacccctgccagcagcggtcgacttgttggttttctgacgccattcattggctcttggtccctccgagggcatacccggtgactgcctccctaggccgccggtcttttccttagacagccatggatgaaaaggcgttcacgaaggagttggatcagtggatcgagcagctgaatgagtgcaagcagctatcggagaaccaggtcaagactctgtgcgagaaggcaaaagaaatcttaacaaaagaatcaaatgtccaggaagttcggtgcccagtcacagtatgtggagatgtacacggacaatttcacgatcttatggaactgttcagaattggaggcaaatcaccagatacaaattatttgtttatgggagactatgttgacagaggatattactctgttgaaactgtaacgctgcttgttgcacttaaggttcgctatcgggaacgcatcacaatcctccgaggaaatcatgaaagtagacaaatcacacaagtatatggattttatgatgaatgcttaaggaaatatggaaatgcaaatgtctggaagtatttcactgacctttttgactacctccccctgactgcactggtagatggtcagatcttttgtttgcacggaggactgtctccttcaatagatacacttgatcatatacgggcccttgatcgccttcaagaagttccacatgagggtccaatgtgtgacttactttggtctgacccagatgatcgtggtggctggggcatatcacctcgaggtgcaggttatacatttggacaggatatatctgaaacattcaaccatgctaatggccttactttggtttcaagagcccatcagctagtgatggaaggatacaattggtgccatgatcggaacgtagtaaccatttttagtgctccaaattattgttaccgctgtggcaaccaagctgcaataatggaacttgacgacacactaaaatattcattcttgcagtttgacccagcaccacgcaggggagagccacatgtgacccgtcgcacacccgactacttcctgtaaacagaattttactcttgtacagtattgctaccagcaggattttgtcatgagatctcggaaaagcagcagtaacttcaaattcaggggagcgttgtcacttatgtactcttaaatgatggaccaaaagatgtgccataaaagcctcttgtttcaacagcccgtgaccaccttagagaccctgtccttgcatgctgaagtggcattgtctgtcaaagagaaaaaaaaaaaaatctgtttcctggcatagcactacttgtagtacatttgctttctcggagagactgcaaaaactaaaacattaacaacacgtgaatacaataactccagttagctatagctctacctggcatgattatagataagatagaaacagtcggattaaccccttctgtgctgcaggggaggcaacagcattctgctgtcttctctggtgtgaaggggatacatggacgtttttaatcaatgcgtaccaagggccctgctgcctttattgtgacttcagatatgtttattttcagggaatacaatttaatttaaatttcatatgcgcttactatttttttttcgtttcacccttccgcatcaattttcaagtctgcgactgttttattttctgtagttaataacaaatacatctgtaccggaaccagatcttctgtaagactttgctgcaggacagtgcagcagtatcctttctttttcccttcccccataataaacttgtgaacaaagtccttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDEKAFTKELDQWIEQLNECKQLSENQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Donor tissue: tailbud