ORFeome > ppp4c – XORFeome 2.0

ppp4c – XORFeome 2.0

General Information

Species: Xenopus tropicalis protein phosphatase 4 (formerly X), catalytic subunit, mRNA (cDNA clone MGC:75928 IMAGE:5383777), complete cds
Gene Symbol: ppp4c
Gene ID: 394540
ORF gb_acc: MG132980
ORF ID: 10360

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061369

Library Location

Plate ID: GDExt11004
Well Location: D07

EST Sequences

Clone: MGC:75928 IMAGE:5383777
Trimmed Sequence: ATGACTGAAATCAGTGACCTCGACCGGCAGATCGAGCAGCTGAGGCGCTGTGAGCTCATCAAGGAGAGCGAAGTGAAAGCTCTTTGTGCCAAAGCGCGAGAGATTCTGGTAGAAGAGAGTAACGTGCAACGAGTCGATTCGCCTGTTACGGTCTGTGGGGATATCCATGGGCAGTTCTACGATCTCAAGGAGTTGTTCAGGGTGGGCGGCGACGTCCCCGAGACAAATTACCTTTTCATGGGTGACTTTGTGGATCGTGGGTTTTACAGCGTTGAAACATTCCTCCTTCTCTTAGCACTAAAGGTTCGTTACCCAGATCGGATCACCCTGATACGCGGCAACCACGAGAGCCGGCAAATCACACAAGTGTACGGTTTCTACGACGAGTGTCTGCGCAAATACGGCTCGGTAACGGTGTGGCGCTACTGCACAGAGATCTTTGACTACCTCAGTCTGTCTGCTATCATAGATGGCAAGATCTTTTGTGTACATGGTGGGCTGTCACCCTCCATTCAGACATTGGATCAGATTAGAACTATTGACCGCAAGCAAGAAGTGCCTCATGATGGACCCATGTGTGACCTGCTCTGGAGTGACCCAGAAGATACTACCGGATGGGGGGTGAGCCCCAGGGGAGCTGGATACCTTTTTGGCAGTGACGTAGTGGCACAATTCAACGCAGCCAACAACATTGATATGATTTGCCGGGCTCACCAGCTTGTCATGGAAGGATACAAGTGGCACTTCAACGAGACTGTCTTAACTGTGTGGTCGGCACCAAACTACTGCTACAGGTGCGGGAATGTCGCCGCCATACTTGAGCTGGACGAACACCTACAGAAAGAATTCATCATATTTGAGGCTGCCCCCCAGGAGACGAGAGGTATCCCCTCCAAGAAACCCGTCGCTGATTACTTCCTGTGA
Full Trace Sequence: ctgtgtggagaggaggaagcgggaggctccggggggagagacccgcacacaccgctccccggatccgtgaagcttcattgaggagggaccatgactgaaatcagtgacctcgaccggcagatcgagcagctgaggcgctgtgagctcatcaaggagagcgaagtgaaagctctttgtgccaaagcgcgagagattctggtagaagagagtaacgtgcaacgagtcgattcgcctgttacggtctgtggggatatccatgggcagttctacgatctcaaggagttgttcagggtgggcggcgacgtccccgagacaaattaccttttcatgggtgactttgtggatcgtgggttttacagcgttgaaacattcctccttctcttagcactaaaggttcgttacccagatcggatcaccctgatacgcggcaaccacgagagccggcaaatcacacaagtgtacggtttctacgacgagtgtctgcgcaaatacggctcggtaacggtgtggcgctactgcacagagatctttgactacctcagtctgtctgctatcatagatggcaagatcttttgtgtacatggtgggctgtcaccctccattcagacattggatcagattagaactattgaccgcaagcaagaagtgcctcatgatggacccatgtgtgacctgctctggagtgacccagaagatactaccggatggggggtgagccccaggggagctggatacctttttggcagtgacgtagtggcacaattcaacgcagccaacaacattgatatgatttgccgggctcaccagcttgtcatggaaggatacaagtggcacttcaacgagactgtcttaactgtgtggtcggcaccaaactactgctacaggtgcgggaatgtcgccgccatacttgagctggacgaacacctacagaaagaattcatcatatttgaggctgccccccaggagacgagaggtatcccctccaagaaacccgtcgctgattacttcctgtgacccgcccaatgatggcctctgcaccatttcctcctgattgtctttttgaactgctcccagcacaactctctctcctcctctcacctctggcaatgggaccagtgctgctgtttctaaacaaatgatttgccagcgcccagctccgctgcagagcatcgccccttcttttctagatccatctcacggagcctcgtgtgtgtgtgtatgtgttaggtagcaacggttgggaagagagagctaccgctgtgtatatagcatggccgtgccgcccatacagtgaattagcaatgccctgccagctcttctagcaaaggaggagatatccggaaactcctgtagccgtgctgcgcctctcaggaaactaggtaaatgtaatgctctgcaggactttcagggggggtcagtgtgatgctttctagtagggagagaggggggggcagcattatgcaaggaaaccaaaatacttctagaattcacagcttcttccttgattttataaccacccccccccccagatccgcagtcattccttataatgtctcttccactcggagcctcacgtcccctgtactaagatgctgagcttacactcacgtacggagtgccttagtgcaagcggggcccgggcgcccaatcccagctggggggggaccaggagagacatgatgatgatgatgatggaacccgccgccccttctctatttagaagctgcggcagatctaagatttgagccccttttggtgccgattggcaacttttgagccaaagtgttcaccgtagctggcccctgtagctcagcgaagccattctgggctgccgggaacgtgagtagccattttgtttaaccctttgtaagcggctagctgagagattgctttggcaaggaggcatctaaagcttcagctcgtgtattgccacctacaatgccaaacctccgattccttccctggaacagccgatattccattataactcccttcctttcgtctatggccccagtctcttgttccgcattctttctggtcaaagattttatcctttttcccttttatttttattttttttttcttctaattttacatttttggtaggatacagttaaacatctgctaataaaatgagaaaaagcaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANNIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKEFIIFEAAPQETRGIPSKKPVADYFL
Donor tissue: neurula