ORFeome > psmd13 – XORFeome 2.0

psmd13 – XORFeome 2.0

General Information

Species: Xenopus tropicalis proteasome (prosome, macropain) 26S subunit, non-ATPase, 13, mRNA (cDNA clone MGC:69415 IMAGE:5335540), complete cds
Gene Symbol: psmd13
Gene ID: 447992
ORF gb_acc: MG133272
ORF ID: 10757

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074506

Library Location

Plate ID: GDExt11007
Well Location: B10

EST Sequences

Clone: MGC:69415 IMAGE:5335540
Trimmed Sequence: ATGAGGGACGTGACCGGATTCCTGCAGCAGCAGCAGAGCCAGAGCTCGGCTCCGGAGACAGCCGCCGTGTGGCACCGACTGGAGGAGCTGCACAATAAGAAGCTTTGGCACCAGCTGACATTGGAACTGCTTGAGTTTGTGCAAGATCCAGAGTGCTCTAAAGGAGATGGACTCATCAAGTTATACGAGAACTTTATCAGTGATTTTGAGCACAGAATTAACCCATTGTCCCTGGTAGAAATTATTCTGCACGTGGTCAGGCAGATGACAGATCCCTCAGTAGCTCTGAACTTCCTGGAGAAAACTCGCGAGAAGGTCAAAAGCAGCGATGAAGCAGTAATACTGTGCAGGACAGCCATCGGAGCCCTGAAACTCAACATTGGGGAGCTGCAGGCCACAAAGGAAACTATTGAGGCAGTGGAAGAGATGTTGGGCGGACTCGCTGGTGTAACCTCTGTGCACAGCCGTTTCTATGACCTTTCCAGCAAGTATTATCAGACCATTGGCAATCACGCCTCTTACTACAAAGATGCATTGCGCTTTCTAGGTTGCACAGACCACAAAGAACTTTCTGTGTCAGAACAGCAAGACAGAGCCTTTACCCTAGGGCTGGCAGGTCTGTTGGGAGATGGAGTCTACAACTTTGGAGAACTGCTGATGCATCCAATCCTGGAATCTTTGCGCAACTCTGACCGGCAGTGGCTAATAGACACTCTTTACGCCTTCAATAGTGGCAATGTGGAGACATTCCGTGGGCTGAAAACTGCTTGGGGACAACAGCCGGATCTTGCTGCTAATGAACCCCTTTTGCTAAAGAAAATCCAATTACTTTGTCTCATGGAGATGACATTTACACGTCCTGCCAATCATCGCCAGCTCACCTTTGAAGAAATCGCTAAGAGCGCACAGGTCACAGTTAATGATGTGGAGCTTCTCGTAATGAAGGCCCTGTCAGTAGGGCTGCTCCGGGGCAGTATTGATGAGGTAGATAAGAGAGTACACATCACTTGGGTGCAGCCACGGGTCCTAGATCTACAACAGATCAAGGGAATGAAAGACCGACTGGAGCACTGGTGCACAGACGTGAAGAGTATGGAAATGCTTGTAGAACACCAAGCTCATGACATCTTGACGTAA
Full Trace Sequence: ttttttttgcccccctcacgttttctagccttgcagtgtctgtgttgagaccgcggagatgagggacgtgaccggattcctgcagcagcagcagagccagagctcggctccggagacagccgccgtgtggcaccgactggaggagctgcacaataagaagctttggcaccagctgacattggaactgcttgagtttgtgcaagatccagagtgctctaaaggagatggactcatcaagttatacgagaactttatcagtgattttgagcacagaattaacccattgtccctggtagaaattattctgcacgtggtcaggcagatgacagatccctcagtagctctgaacttcctggagaaaactcgcgagaaggtcaaaagcagcgatgaagcagtaatactgtgcaggacagccatcggagccctgaaactcaacattggggagctgcaggccacaaaggaaactattgaggcagtggaagagatgttgggcggactcgctggtgtaacctctgtgcacagccgtttctatgacctttccagcaagtattatcagaccattggcaatcacgcctcttactacaaagatgcattgcgctttctaggttgcacagaccacaaagaactttctgtgtcagaacagcaagacagagcctttaccctagggctggcaggtctgttgggagatggagtctacaactttggagaactgctgatgcatccaatcctggaatctttgcgcaactctgaccggcagtggctaatagacactctttacgccttcaatagtggcaatgtggagacattccgtgggctgaaaactgcttggggacaacagccggatcttgctgctaatgaaccccttttgctaaagaaaatccaattactttgtctcatggagatgacatttacacgtcctgccaatcatcgccagctcacctttgaagaaatcgctaagagcgcacaggtcacagttaatgatgtggagcttctcgtaatgaaggccctgtcagtagggctgctccggggcagtattgatgaggtagataagagagtacacatcacttgggtgcagccacgggtcctagatctacaacagatcaagggaatgaaagaccgactggagcactggtgcacagacgtgaagagtatggaaatgcttgtagaacaccaagctcatgacatcttgacgtaaatcccctgttcgctgtattctaaagcagagaccacacctgtgccctctccattaagggatgctacatctgtcctctctgcgtaggggtggaaaaaaaggactaaaatgggagcagcccggttccacctgatgtttgaaacatctgacctgttctatttttggcttaataggacacagcctctttgttatattggatgtgtgtctgcactgatatcgcaacatgaaataaaccatttctgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRDVTGFLQQQQSQSSAPETAAVWHRLEELHNKKLWHQLTLELLEFVQDPECSKGDGLIKLYENFISDFEHRINPLSLVEIILHVVRQMTDPSVALNFLEKTREKVKSSDEAVILCRTAIGALKLNIGELQATKETIEAVEEMLGGLAGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCTDHKELSVSEQQDRAFTLGLAGLLGDGVYNFGELLMHPILESLRNSDRQWLIDTLYAFNSGNVETFRGLKTAWGQQPDLAANEPLLLKKIQLLCLMEMTFTRPANHRQLTFEEIAKSAQVTVNDVELLVMKALSVGLLRGSIDEVDKRVHITWVQPRVLDLQQIKGMKDRLEHWCTDVKSMEMLVEHQAHDILT
Donor tissue: tailbud