ORFeome > ptma – XORFeome 2.0

ptma – XORFeome 2.0

General Information

Species: Xenopus tropicalis prothymosin, alpha, mRNA (cDNA clone MGC:69494 IMAGE:5336320), complete cds
Gene Symbol: ptma
Gene ID: 549277
ORF gb_acc: MG134246
ORF ID: 11907

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090592

Library Location

Plate ID: GDExt11018
Well Location: B11

EST Sequences

Clone: MGC:69494 IMAGE:5336320
Trimmed Sequence: ATGTCCGACACAGCAGTGGACGCCAGCGTTGAGAAAACCCCCAAGGACTTAAAAGCAAAAGAGAAGGAAGTTGTAGAAGAAGCAGAAAATGGAAAGGACAAGCCTACCAATGGAAATGCAGAAAATGAGGAAAATGGTGAGCAAGAGAATGAAGGTGATGAAGAAGAAGAGGTAGATGAGGAAGATGAAGAGGATGAAGTAGAAGGAGATGATGATGATGAAGACGACGAAGTAGAGGGAGCCACTGGCAAGAGAGCAGCAGAAGATGATGAGGATGATGATGATGATGTTGAAACAAAGAAGCAGAAAACAGATGAAGACGACTAG
Full Trace Sequence: agaaataaaaagccatctttgcattgttcctgtaacactcgcttccagctcccgggacctgcacaattactttggttttttgtatatagcttattttattatattaagaatgtccgacacagcagtggacgccagcgttgagaaaacccccaaggacttaaaagcaaaagagaaggaagttgtagaagaagcagaaaatggaaaggacaagcctaccaatggaaatgcagaaaatgaggaaaatggtgagcaagagaatgaaggtgatgaagaagaagaggtagatgaggaagatgaagaggatgaagtagaaggagatgatgatgatgaagacgacgaagtagagggagccactggcaagagagcagcagaagatgatgaggatgatgatgatgatgttgaaacaaagaagcagaaaacagatgaagacgactagagtggggaattgtccctgtctcaaaataaagtctatatataaccttacccccaccgcctgccctcaactctcaaatatgggtcacagaaaagtagttcttccgtcccgacccctcatgcagcctctttggccccccatcctccgtccacaaatgacaccacctccaaaggtgccagtcacagtgcccacaaggctttgtttttgtttaaatttttttactttctgcaacaacctgtgggtcacttcagccagggtttagccctgcactgccagtatagaatgcactcatttgctttcctttccagtcataatgttgttttgggtggggtggaattgttcattaaaattctagaggggttattttgcttttttcctttttataaaaactgggaaaacaaacgccttggaaggggtcctctgtttgtattttttatttacattttatatttttgtacatattggtatacaactgtccttttctgtactggggatctgactgccagggtgttgggggggcttttaaattaatattttttttgtcccccccccccccctcctttttgataattgttcccatggctatatatatggaggaaaaaaaaccttgcattttttaacccccttttctgggttggggggaagggcggtgggaggtgtggaggtgagagctgtctcttctccaaatggcaaaatctttacaaaaaaagcaaaaattgttataaaaaaaacttaaaataaataagacaaaacccccaatataaaattctgatcattccagtaactttttgaacatatttttagctgtactttagatgagtttggatgagaatggccaaagatttttcttttgtttttgtctctgaaattgctttttttttgttttgttttgtttggcctgattggatgtgtgtggcagtattgtcaataaaactgcaattttaatttgcaggctttccttttgttctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSDTAVDASVEKTPKDLKAKEKEVVEEAENGKDKPTNGNAENEENGEQENEGDEEEEVDEEDEEDEVEGDDDDEDDEVEGATGKRAAEDDEDDDDDVETKKQKTDEDD
Donor tissue: tailbud