ORFeome > rab9a – XORFeome 2.0

rab9a – XORFeome 2.0

General Information

Species: Xenopus tropicalis RAB9A, member RAS oncogene family, mRNA (cDNA clone MGC:147337 IMAGE:7868619), complete cds
Gene Symbol: rab9a
Gene ID: 780093
ORF gb_acc: MG135700
ORF ID: 13818

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC123091

Library Location

Plate ID: GDExt11037
Well Location: D02

EST Sequences

Clone: MGC:147337 IMAGE:7868619
Trimmed Sequence: ATGTCTGCCAAATCCTCACTGCTGAAAATAATTCTTCTGGGAGATGGAGGAGTGGGAAAAAGTTCTCTCATGAATAGATACGTCACTAATAAGTTTGATACACAGTTATTCCACACAATAGGCGTTGAGTTTCTCAATAAAGAGCTGGAAGTGGATGGTCATTTGGTTACAATGCAGATCTGGGACACTGCAGGCCAGGAGCGCTTTCGGAGCCTGAGAACTCCCTTTTATAGGGGTTCAGATTGCTGTTTACTCACATTCAGTGTTGATGATTCTCAAAGTTTTCAAAACCTGACCAACTGGAAAAAGGAATTTATCTACTATGCAGATGTCAAAGATCCTGACAGCTTTCCTTTTGTTATCTTGGGAAACAAAATAGACATCACAGACCGCCAGGTGTCCGTTGAAGAGGCCCAGGCCTGGTGCAGAGACAATGGAAATAATCCTTATTTTGAAACTAGTGCTAAAGATGCCACAAATGTTGCTGCAGCTTTTGAAGAAGCTGTTAGGAGGGTTTTAGCCATAGAGGATAGATCAGATCAGCTAATAAACACAGATACAGTTAACCTGCATAGAAAACCTAAGCCAACTACTGCTTGCTGTTGA
Full Trace Sequence: ctgtatttaggagtcgtgtttgctaaatatgcttgtctgatttatacattgatatggaattgtaaaccaagctctccattatacaggcgttaatgcttacaaatatttctgtgctcacaaagccatagcaagtccatagcaaatatttcttttagtttcttttcctagacaggtatgagctttatttggttatcatttgcagattgttcatcacatttacatccattccccagtgggatttagaatatgagatgtcctgcctatcacatgcacgcaaccggcttgcttcactttcatagggggctctgtaacctggctgtatattttgttttcatttataatgtggaaagactaagcgatttgctggatatgatggaaaagtgattgctggaccagcagttgaaaagataaagctaatgttggctggtttcctaggggttaatattttgtcactaggacagaagtgcaggatgtgacagcacaggcctcggatctagggtggcaatcaatcgattggtcttattaaggaatctctatcagctaatgatttaacatttatatttgttttagaaatctgaaaatgatctgttgtgctttgagactgctgaatgtaaaatgcccagaaatcagatgctgactgatattaaaaactaaagtggggaaacaagatcatcacttttaaaggaagattgtgtctgttacaatgtctgccaaatcctcactgctgaaaataattcttctgggagatggaggagtgggaaaaagttctctcatgaatagatacgtcactaataagtttgatacacagttattccacacaataggcgttgagtttctcaataaagagctggaagtggatggtcatttggttacaatgcagatctgggacactgcaggccaggagcgctttcggagcctgagaactcccttttataggggttcagattgctgtttactcacattcagtgttgatgattctcaaagttttcaaaacctgaccaactggaaaaaggaatttatctactatgcagatgtcaaagatcctgacagctttccttttgttatcttgggaaacaaaatagacatcacagaccgccaggtgtccgttgaagaggcccaggcctggtgcagagacaatggaaataatccttattttgaaactagtgctaaagatgccacaaatgttgctgcagcttttgaagaagctgttaggagggttttagccatagaggatagatcagatcagctaataaacacagatacagttaacctgcatagaaaacctaagccaactactgcttgctgttgactgtagcatttgaaaggcaataaccctttaacccatttagcactaagtgaaaccagccatgcaagcccataaagatggcggtcatgcatgtagcattgtttgggtaaacaaaatgaagaatatctaataattaggtctgtgaggacatcaaataattaaaattggtttggctaaaacagagctgttctagcttcttgcacaatgaatggtatcatttattaaaatattattttgacttaggatttaataaaatacttcactgaagtacaagtacttgtttctgtggacacattgagttcttacatctatcctcttattgcaatgcagacataagttctttgtattctgcatcgctaagggcaatggcacatgttgtgattttggccacttctgtgctcagtatttttaatattttagagggtaatggcaaattgcctgaatttgtgcccaccactttcaggcaattaccacagcatgcagtggagggcaaattggtactggtgcaaagttgcccagtgtgtcatatccctaaaagaatgcagtaatgaattagctaatttttaaagggatagaacctgcagatttgcaaactagaagtgtcaaagcactcaaggggtcacaaccactgtgtagaccatatacattggatatggggggtctatacacccctgcaaaatggcaggtttttgcttaacaaaaaaaaaaacaagataaatcctgccacaacttattccacatttattgcaaaataaacaaatcagaaaccttttagtgaaagaaggaaaagcaaaaaaa
Translation: MSAKSSLLKIILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKELEVDGHLVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLTNWKKEFIYYADVKDPDSFPFVILGNKIDITDRQVSVEEAQAWCRDNGNNPYFETSAKDATNVAAAFEEAVRRVLAIEDRSDQLINTDTVNLHRKPKPTTACC
Donor tissue: skin