ORFeome > rad9a – XORFeome 2.0

rad9a – XORFeome 2.0

General Information

Species: Xenopus tropicalis RAD9 homolog A (S. pombe), mRNA (cDNA clone MGC:89062 IMAGE:7005749), complete cds
Gene Symbol: rad9a
Gene ID: 448287
ORF gb_acc: MG134107
ORF ID: 11731

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075359

Library Location

Plate ID: GDExt11017
Well Location: F05

EST Sequences

Clone: MGC:89062 IMAGE:7005749
Trimmed Sequence: ATGGGAGAAGGTGTAAAGTGTGTAATTACTGGAACCAATATCAAAGCACTTGGGCGAGCTGTACACTCCCTCTCGCGAATAGGAGATGAGTTATATTTTGAGCCATTGGAAGATGGGCTTTGTCTGCGCTCTGTCAATTCATCGCGATCAGCTTATGCCTCTTTCACACTTGCACCCCTGTTTTTCCACAGTTATGAGGCAACAGGTGGAACCTGCCACTGCAAGATTCACATGAAGACAGTGATTAGTGTTTTCCGCTCCCTCCCATCTTTGGAGAAGACTGTAGAAAAATGTCTTATCAGCCTCAATGCAGAAAAGAGTCGACTAGTCATCCAACTTTTGTGCAAATATGGAATTACAAAAACACACAACTTATCATATCAGGACTGTGAGTCTTTACAGGCTGTGTACAACCCGGATACCTGTCCAAATATGCTGAGAGCTCCTGCAAGACTGCTCTCTGATGCCGTGATGCACTTTCCTCAGACTCTTGCAGAGATTACAATAATGGCTAGTCCTTGTGGAAAAGTTACACTGCGAAATTATGTTGAGGAGGATATAGATTCAACTAAAACCATGCTAACAGAGCTATCCCTGAGTAGGGATGAATTTCTGGTATACCAGCTAAAGAAACAGAGTGACATAACCTTCTGTTTGCGTGAATTCCGGGGTCTTCTGAGTTTTGCTGAATCGACAAGCCTTCCAGTCTCTATACACTTCAACACTGCTGGTTTTCCAGCTGTGTTCAGTGTTGATGATACAGTACTTGAAGTGCATTTTGTTCTTGCTACTCTTTCCGACACAGACAGAGCATCACAGTCGGAGTCTCAGTACAACAGGCCTCCCTTGCATTCATCAGAGGATGACTTTTTAGGTGATGATATTGATTATATGATTGCAATGGAAACGACGGTTACACATTCTCCACCACCCAGTAGTCCTACCTTCTGTGGTCATTCATGCATAAATCCTTTCCAAGAAGCCCAGGATCCACTAAGTGATGATGAACCAGATGCAGGAGTTCCTGGGACACCTCCCAACAAGAAGTTTCGGTCCCTTTTTTTTGGATCTATTCTGGCAAACTCTGGTCATTCAAATCAAGAAATTTTGGCTGAAGATAGTGACAGAGAAGAAGAATAA
Full Trace Sequence: gagaagcggacctgtccagctaaaagcgggactattgggcgctgtagtgcaagaggaagttctctaaatgaagattgaaggggttctcctttcaaaaacttgttttgcttatagaaagttaatgagctgcattgtcattcaacactattatgggagaaggtgtaaagtgtgtaattactggaaccaatatcaaagcacttgggcgagctgtacactccctctcgcgaataggagatgagttatattttgagccattggaagatgggctttgtctgcgctctgtcaattcatcgcgatcagcttatgcctctttcacacttgcacccctgtttttccacagttatgaggcaacaggtggaacctgccactgcaagattcacatgaagacagtgattagtgttttccgctccctcccatctttggagaagactgtagaaaaatgtcttatcagcctcaatgcagaaaagagtcgactagtcatccaacttttgtgcaaatatggaattacaaaaacacacaacttatcatatcaggactgtgagtctttacaggctgtgtacaacccggatacctgtccaaatatgctgagagctcctgcaagactgctctctgatgccgtgatgcactttcctcagactcttgcagagattacaataatggctagtccttgtggaaaagttacactgcgaaattatgttgaggaggatatagattcaactaaaaccatgctaacagagctatccctgagtagggatgaatttctggtataccagctaaagaaacagagtgacataaccttctgtttgcgtgaattccggggtcttctgagttttgctgaatcgacaagccttccagtctctatacacttcaacactgctggttttccagctgtgttcagtgttgatgatacagtacttgaagtgcattttgttcttgctactctttccgacacagacagagcatcacagtcggagtctcagtacaacaggcctcccttgcattcatcagaggatgactttttaggtgatgatattgattatatgattgcaatggaaacgacggttacacattctccaccacccagtagtcctaccttctgtggtcattcatgcataaatcctttccaagaagcccaggatccactaagtgatgatgaaccagatgcaggagttcctgggacacctcccaacaagaagtttcggtcccttttttttggatctattctggcaaactctggtcattcaaatcaagaaattttggctgaagatagtgacagagaagaagaataatgacaacacatttgacaacgcattgcctgctaaccatttattctgaattcagaactggtagataatgaccaatggaacaaaaacacttgcatctttacacagaatagtagtgaagtaattgatgaatttattttcatcttaactggaacagaagcctttgttgttttttgacacatttcctgaaagcatggttatatatgtcatagaagctgatgcagaaattcggggtttctatgctgccatgtaatatgaatctaaatgaattactgaccaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGEGVKCVITGTNIKALGRAVHSLSRIGDELYFEPLEDGLCLRSVNSSRSAYASFTLAPLFFHSYEATGGTCHCKIHMKTVISVFRSLPSLEKTVEKCLISLNAEKSRLVIQLLCKYGITKTHNLSYQDCESLQAVYNPDTCPNMLRAPARLLSDAVMHFPQTLAEITIMASPCGKVTLRNYVEEDIDSTKTMLTELSLSRDEFLVYQLKKQSDITFCLREFRGLLSFAESTSLPVSIHFNTAGFPAVFSVDDTVLEVHFVLATLSDTDRASQSESQYNRPPLHSSEDDFLGDDIDYMIAMETTVTHSPPPSSPTFCGHSCINPFQEAQDPLSDDEPDAGVPGTPPNKKFRSLFFGSILANSGHSNQEILAEDSDREEE
Donor tissue: