ORFeome > rbbp6 – XORFeome 2.0

rbbp6 – XORFeome 2.0

General Information

Species: Xenopus tropicalis retinoblastoma binding protein 6, mRNA (cDNA clone MGC:75882 IMAGE:5383105), complete cds
Gene Symbol: rbbp6
Gene ID: 394578
ORF gb_acc: MG133031
ORF ID: 10423

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061346

Library Location

Plate ID: GDExt11004
Well Location: D10

EST Sequences

Clone: MGC:75882 IMAGE:5383105
Trimmed Sequence: ATGTCGTGTGTGCATTATAAGTTTTCCTCCAAACTCAACTATGACACGGTGACCTTTGATGGCCTGCACATCTCCCTGTGCGACCTGAAGAAACAGATCATGGGCCGAGAGCGACTAAAGGCCACCGACTGCGACCTGCAGATCACCAATGCCCAGACACAGGAAGAATACACAGATGAGACTGTACTTATTCCTAAGAACTCATCTGTCATTGTTCGAAGAATTCCCATCGGGGGTGTAAAGACAGCAAGCAAAAGTTATGTCATAAGCCGTACAGAACCACAGAGTGGAACATCAAAATCAATTGAGGACGCTTCATCTATTTCTCTGGCCCAGCTAACTAAGGTATATATATTACACATTGGCAACTACCTGTGTCATAATGTACTTCTATAA
Full Trace Sequence: ctcctggacacggactgaaccatctgggacacggactgaaccaccttgtgcgctgattgggaacgggttgaaacattttgggacacgaactgtgctccccattggggccctgaggggaaccttctgggacacggacttattttcttggggacaaggactgagcagggacttgccacctggataggtctggactattgaactgttcattctccacaaagaattcccaacccttggactttatagaagagcaggcgattggcctggagtgtggggggagggcagggggccatgctgcccgcctgatgggctcctctggtgcctgtgtggtgccctggcattgcacattggtgtgacctatgctgagcctctcctgtgtgcctgtgtgtgtgttgtgctgagtgcgtgcgtccgatcccttttgtctctgtatctgtaggtatagaaaggccgctaacatgtcgtgtgtgcattataagttttcctccaaactcaactatgacacggtgacctttgatggcctgcacatctccctgtgcgacctgaagaaacagatcatgggccgagagcgactaaaggccaccgactgcgacctgcagatcaccaatgcccagacacaggaagaatacacagatgagactgtacttattcctaagaactcatctgtcattgttcgaagaattcccatcgggggtgtaaagacagcaagcaaaagttatgtcataagccgtacagaaccacagagtggaacatcaaaatcaattgaggacgcttcatctatttctctggcccagctaactaaggtatatatattacacattggcaactacctgtgtcataatgtacttctataaacataatccttctgtacaattggcctgaatattctccttcggtcatacatggtgtgtgtagtagtgtcctgtaaagagtagcagccagtctcagaaccgaaaggaaaaatggagccccccccaccaggcaccataatccattttcacagcaaagaaaataaaatgctgaagctgtcggcaccaagaaatctactccttaaccctttggtgggtttttttttcctacccccaagaattttttccatccattttaagaagaatggcattttacattatataacctatggactagtctggttcaatccaggatgatggagttaccgcatttaattcttcagcagctctaaatgtcaactcttcgttttatagatatgttcctcggaactattgttttgctggcgtgacgtggattattgctaaaacgtcacactaaattgccagcgcacacctcagttcttaagggtttgcttcccctttactttatggacaattgaagttgatttcattgtgacaattaaaacgtcatgcctgaaactgagcgtactttagtgctgttagacttttatatgcactttttctcaccatttttacctttttaccgggtttatcgcagctttatgatctgtaaatggtttaatagtgaattcctgtctgtaataatgacgtctgtaataaaatcttcaacctgtgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGRERLKATDCDLQITNAQTQEEYTDETVLIPKNSSVIVRRIPIGGVKTASKSYVISRTEPQSGTSKSIEDASSISLAQLTKVYILHIGNYLCHNVLL
Donor tissue: neurula