ORFeome > rcan1 – XORFeome 2.0

rcan1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis regulator of calcineurin 1, mRNA (cDNA clone MGC:69428 IMAGE:5335670), complete cds
Gene Symbol: rcan1
Gene ID: 448016
ORF gb_acc: MG133261
ORF ID: 10744

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074532

Library Location

Plate ID: GDExt11007
Well Location: B09

EST Sequences

Clone: MGC:69428 IMAGE:5335670
Trimmed Sequence: ATGCACTTCAGGAACCTGAACTACAGCTTCGCCTCTCTGGTAGCCTGTGTGGCCGAGACCGAGCTCTTCTATCAGAGTGAAGCCAGGACAAAATTTGAATCGCTCTTTAAGGCCTACGACAAGGAAGCCACCTTTCAGTATTTTAAGAGCTTCAAGCGGGTGAGGATCAACTTTAGCAATCCCATCTCTGCGGCCGAGGCCAGGATCCAGCTGCACAAAACCGAGTTCCTGGGGAAGGAGATCAAGTTATATTTTGCTCAGACGCTGCACATAGGAAGCCCCCATCTTGCCCCACCAAATCCAGAGAAGCAGTTCCTGATCTCCCCTCCCTCCTCACCTCCCGTGGGTTGGAAGCAGATGGAGGACACAAGTCCCGTGATCAACTATGACCTGCTATACGCCATCTCTAAACTCGGCCCAGGAGAGCAATACGAATTGCATGCTGCAACAGACACGACTCCAAGCGTTGTAGTTCATGTCTGTGAGAGCGATCCAGAGAATGAACTGGAAATCGAGGAAGATGAAGATGGTATGAGCAAGCCCAAGCCAAAAATCATCCAGACAAGGAGACCAGAGTATATGCCTATCCATCTAAGTTGA
Full Trace Sequence: cagaacctccacagctgccttggcttagagatatcagccgtaaccatgcacttcaggaacctgaactacagcttcgcctctctggtagcctgtgtggccgagaccgagctcttctatcagagtgaagccaggacaaaatttgaatcgctctttaaggcctacgacaaggaagccacctttcagtattttaagagcttcaagcgggtgaggatcaactttagcaatcccatctctgcggccgaggccaggatccagctgcacaaaaccgagttcctggggaaggagatcaagttatattttgctcagacgctgcacataggaagcccccatcttgccccaccaaatccagagaagcagttcctgatctcccctccctcctcacctcccgtgggttggaagcagatggaggacacaagtcccgtgatcaactatgacctgctatacgccatctctaaactcggcccaggagagcaatacgaattgcatgctgcaacagacacgactccaagcgttgtagttcatgtctgtgagagcgatccagagaatgaactggaaatcgaggaagatgaagatggtatgagcaagcccaagccaaaaatcatccagacaaggagaccagagtatatgcctatccatctaagttgaagtggggtcggcagcattttgcggtgaaacccaatgaactcgtttaaatcttttactgcaggaaacggcagagcgcggtgtaggacagctgcggtagtggtctgactttgtcagtcggcagaaccaaaccaggacgttttgtgtttgcttttatttttttgtatacgccgaatgccaatgtaacatttggaatgtcccgccgggttgatggaaacgtggaaaaaaactgaagcttcacgagcatatttagcttgattattcttttctagagggtctaggaaaagtggaactttaagggcccctcgtttgctggaagtgcggaaccaggaatgtcgtcgatataacgtcactgcggtgtattgttggagagactgtgcccaagcacacagtataggacgccatatctccaccttgtatgatggaaccttttcatcgttccagaacaagaggagaatggatcaatgtggttttttttttttgcatgtagactatatgattttttctaaatattctactttgtgttaacagctgcttacttggccctgcgaaatccaaaccctgttatgtgatcacaaaaagtagaacgcatggtccattattgggaaacactgtggcactacagggagggcccctgttatgttttctagcgaatgaactgtaatgtacgctttaacgcaagggaaaatgtgcttaggtttctgtttctctatagggaaatgtgtaatatagaactaaagccaggctggcaagctcgctaataagttacacgctgaaatagggcacaatgggattttgtaattgtgggatatacatgttggtggctgcagggtgagcctattgctttacctgttgcaattctgtctttcttgacaagaactgaatgaatttaaagtgttattaattcatatcagccatttttttcttgtcttagacttagcctatagccggggagtaagctatcaatggcattacaggcaagccaaggtggagctttagaaatcaatccattgggtaaatgcggctaagccccatacccaaaaaaaacagaatatgtttaagatttaactatggtggtaaaggaatgtgactcgcgggtggtcattttttgggtaatccagtgcctttcactttggttatgaatgggggggtatcacagtgttagaaccgctgtacctattgtatccttccccagttctatttccctcatctgcctgttctgatgacaagctggcattgcagccccaatacaggttttgctttgccatactctgcccgcccagataatgagggtaacgttggcagcaccttctgtgtcttgtaataaaccagataaatacctcccattgtaataggcctctgggcaccccccatgtagagcgagagaggtttctacgtgtgttgtgtattacgtctggttactactcattcacattgtttttgaagtctgcttttaaactggaagtttgaatctctcttttctgttttatattcacttgtattaagataataaacttcctttgttattagaatgtatattatttcatggttaaatgattcccttttctctgtaataataaaacagtacctgtacttgatcccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MHFRNLNYSFASLVACVAETELFYQSEARTKFESLFKAYDKEATFQYFKSFKRVRINFSNPISAAEARIQLHKTEFLGKEIKLYFAQTLHIGSPHLAPPNPEKQFLISPPSSPPVGWKQMEDTSPVINYDLLYAISKLGPGEQYELHAATDTTPSVVVHVCESDPENELEIEEDEDGMSKPKPKIIQTRRPEYMPIHLS
Donor tissue: tailbud