ORFeome > rpl18 – XORFeome 2.0

rpl18 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ribosomal protein L18, mRNA (cDNA clone MGC:89878 IMAGE:7029272), complete cds
Gene Symbol: rpl18
Gene ID: 496439
ORF gb_acc: MG133126
ORF ID: 10565

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082960

Library Location

Plate ID: GDExt11006
Well Location: F01

EST Sequences

Clone: MGC:89878 IMAGE:7029272
Trimmed Sequence: ATGGGAGTAGATATCCGTCACAACAAGGACCGCAAGGTGCGGCGAAAGGAGCCCAAGAGCCAGGATATCTATCTGAGGCTTTTAGTAAAGCTTTATCGTTTCTTGGCCAGACGTACCAACTCAAGTTTCAACAGGGTGGTTCTGAAGCGTCTGTTCATGAGCCGAACCAACAGGCCACCCCTCTCTTTGTCCCGTCTTATTCGCAAAATGAAATTGACAGGGCGTGAAAACAAGACTGCAGTGGTGGTGGGATGTATCACAGATGATGTCAGGATCCATGATATCCCTAAACTGAAGGTGTGCGCACTTAAAATGACCGGTGGAGCACGTAGCCGAATCCTGAAGGCTGGAGGTCAGATCATGACATTTGACCAGCTTGCCCTTGCTGCCCCTAAAGGCCAGAACACTGTTCTTCTATCAGGACCTCGTAAGGCCCGTGAAGTATACAGACACTTTGGCAAGGCACCTGGTACTCCACACAGTCACACTAAGCCTTATGTGCTTTCCAAGGGTAGAAAGTTTGAGCGCGCCAGAGGACGCAGAGCCAGCAGAGGATACAAGAACTAA
Full Trace Sequence: gaccttgtgttcccataagcctgttcgccgcgcctgtctctttcctttcctccccgagaagccgctgctgctacagccgccatcatgggagtagatatccgtcacaacaaggaccgcaaggtgcggcgaaaggagcccaagagccaggatatctatctgaggcttttagtaaagctttatcgtttcttggccagacgtaccaactcaagtttcaacagggtggttctgaagcgtctgttcatgagccgaaccaacaggccacccctctctttgtcccgtcttattcgcaaaatgaaattgacagggcgtgaaaacaagactgcagtggtggtgggatgtatcacagatgatgtcaggatccatgatatccctaaactgaaggtgtgcgcacttaaaatgaccggtggagcacgtagccgaatcctgaaggctggaggtcagatcatgacatttgaccagcttgcccttgctgcccctaaaggccagaacactgttcttctatcaggacctcgtaaggcccgtgaagtatacagacactttggcaaggcacctggtactccacacagtcacactaagccttatgtgctttccaagggtagaaagtttgagcgcgccagaggacgcagagccagcagaggatacaagaactaaattcactcttcatgctttgtacacaataaagttctttggacttggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSSFNRVVLKRLFMSRTNRPPLSLSRLIRKMKLTGRENKTAVVVGCITDDVRIHDIPKLKVCALKMTGGARSRILKAGGQIMTFDQLALAAPKGQNTVLLSGPRKAREVYRHFGKAPGTPHSHTKPYVLSKGRKFERARGRRASRGYKN
Donor tissue: