ORFeome > rps25 – XORFeome 2.0

rps25 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ribosomal protein S25, mRNA (cDNA clone MGC:89663 IMAGE:7026122), complete cds
Gene Symbol: rps25
Gene ID: 448660
ORF gb_acc: MG133073
ORF ID: 10490

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077007

Library Location

Plate ID: GDExt11005
Well Location: E03

EST Sequences

Clone: MGC:89663 IMAGE:7026122
Trimmed Sequence: ATGCCGCCAAAGGACGATAAGAAGAAGAAGGATGCTGGCAAATCTGCCAAGAAGGACAAAGATCCAGTTAACAAGTCTGGAGGCAAGGCCAAGAAGAAGAAGTGGTCCAAGGGGAAAGTGAGAGACAAGTTGAACAACTTGGTGCTCTTTGACAAGGCCACTTATGACAAGCTGTGCAAGGAGGTTCCCAACTACAAGCTCATCACACCCGCTGTTGTTTCTGAGAGGCTTAAGATCAGGGGCTCACTGGCCAGAGCTGCACTGCAGGAGTTGCTCAACAAAGGTTTAATAAAACTTGTGTCAAAACATAGAGCACAGGTTATCTACACTAGAAATACTAAAGGAGGAGATGCTCCTGCAGGAACAGAAGAGTCTTAA
Full Trace Sequence: ttttctgtccgacatctttgaaggagcagcagcatgccgccaaaggacgataagaagaagaaggatgctggcaaatctgccaagaaggacaaagatccagttaacaagtctggaggcaaggccaagaagaagaagtggtccaaggggaaagtgagagacaagttgaacaacttggtgctctttgacaaggccacttatgacaagctgtgcaaggaggttcccaactacaagctcatcacacccgctgttgtttctgagaggcttaagatcaggggctcactggccagagctgcactgcaggagttgctcaacaaaggtttaataaaacttgtgtcaaaacatagagcacaggttatctacactagaaatactaaaggaggagatgctcctgcaggaacagaagagtcttaattcgaattggactcttgactggagaatttttctgtgtaaatgtgattacaaaaaataaactgttctgagaaaaaaaaaaaaaaaa
Translation: MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLNKGLIKLVSKHRAQVIYTRNTKGGDAPAGTEES
Donor tissue: