ORFeome > sat1 – XORFeome 2.0

sat1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis spermidine/spermine N1-acetyltransferase 1, mRNA (cDNA clone MGC:79460 IMAGE:5380899), complete cds
Gene Symbol: sat1
Gene ID: 493359
ORF gb_acc: MG133585
ORF ID: 11121

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080875

Library Location

Plate ID: GDExt11011
Well Location: B01

EST Sequences

Clone: MGC:79460 IMAGE:5380899
Trimmed Sequence: ATGGCCAAATTTATCATACGATCTGCTAATGCCGGGGACTGTAAAGATATCTTGCGACTCATAAAGGAACTGGCAAAATATGAAGATATGGAGAACCAAGTAGTACTAACTGAGAAAGATCTGCTTGAAGATGGATTTGGAGAACATCCATTTTACCACTGTCTTGTTGCTGAAGTGCCTAAGGAGACCCAGAGTGCTGATGGATACACCATTGTTGGGTTTGCAATGTACTACTTCACCTATGACCCGTGGATTGGAAAATTGCTTTATCTTGAAGACTTCTTTGTGATGGATGAGTTCAGAGGTTTTGGCATGGGATCAGAGATATTCAAGCACTTGAGTCAAATTGCGATGAAGTGCCGTTGTAGCAGCATGCACTTCCTGGTTGCAGAATGGAATGAGCCGTCCATAAAGTTCTACAAGAGACGTGGAGCAGCTGACCTTTCTACAGAAGAAGGATGGCGCCTCTTCAAAATCGATAAAGAATACTTGTGTAAACTTGCCGCTGAAGAGTGA
Full Trace Sequence: aagttttcttatcacggtggctgcagtgagtgagctctgccgggtcagggtcccagactgactaaggagaggaaactcctgggaagcgaatgaagaaacacctcctactactcttcacatacagaggacttgtcagaaaaggcaaaaagagcaagagaagaaaatggccaaatttatcatacgatctgctaatgccggggactgtaaagatatcttgcgactcataaaggaactggcaaaatatgaagatatggagaaccaagtagtactaactgagaaagatctgcttgaagatggatttggagaacatccattttaccactgtcttgttgctgaagtgcctaaggagacccagagtgctgatggatacaccattgttgggtttgcaatgtactacttcacctatgacccgtggattggaaaattgctttatcttgaagacttctttgtgatggatgagttcagaggttttggcatgggatcagagatattcaagcacttgagtcaaattgcgatgaagtgccgttgtagcagcatgcacttcctggttgcagaatggaatgagccgtccataaagttctacaagagacgtggagcagctgacctttctacagaagaaggatggcgcctcttcaaaatcgataaagaatacttgtgtaaacttgccgctgaagagtgaaaactctcccagaggcagcaaatatctcaataaaagaataacattgattgtttgcatgtcattattatagtgtaattgtagaatagctcatgcaaaagctttattaccagtggcattgtaatgtggttgtctccatatcctcatagcgaaactttttgtggcagcatcttcaagttcttcaaacattagtttctcggttgtctgtattatatgtaacttcattgttgtaagtcatttgtgtacaatgtacacactggtatgtaggtttcaatttgtactattcaattaacctgtttttataaattaaagagcagtttttgttctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAKFIIRSANAGDCKDILRLIKELAKYEDMENQVVLTEKDLLEDGFGEHPFYHCLVAEVPKETQSADGYTIVGFAMYYFTYDPWIGKLLYLEDFFVMDEFRGFGMGSEIFKHLSQIAMKCRCSSMHFLVAEWNEPSIKFYKRRGAADLSTEEGWRLFKIDKEYLCKLAAEE
Donor tissue: tadpole