ORFeome > sec22l1 – XORFeome 2.0

sec22l1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis sec22l1 protein, mRNA (cDNA clone MGC:76190 IMAGE:5335844), complete cds
Gene Symbol: sec22l1
Gene ID: 394761
ORF gb_acc: MG132683
ORF ID: 9973

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061616

Library Location

Plate ID: GDExt11001
Well Location: A01

EST Sequences

Clone: MGC:76190 IMAGE:5335844
Trimmed Sequence: ATGGTCCTGCTAACGATGATCGCCCGAGTGGCTGACGGGCTCCCGCTGGCTGCTTCCATGCAGGAGGACGAACAGTCAGGCAGGGACCTGCAGCAGTACCAGAACCAGGCCAAGCAGTTGTTCCGCAAGCTGAATGAACAGTCTCCAACGCGGTGCACCCTGGAGGCAGGAGCCATGACCTTCCACTATCTGATTGAGAAAGGTGTTTGTTATCTGGTTCTCTGTGAAGCTGCTTTCCCCAAGAAGCTGGCCTTTGCTTATCTGGAAGATCTGTTTTCTGAATTTGACGAACAACATGGGAAGAAAGTGCCCACCGTGTCACGGCCATACTCCTTTATAGAGTTCGATAACTACATCCAGAAGACAAAGAAGTCATACATCGACAGCCGAGCCAGAAGAAATCTTAGTTCTGTTAACACTGAGCTGCAGGATGTGCAGAGAATCATGGTTGCTAATATTGAAGAAGTTTTGCTTCGGGGAGAAGCACTTTCAGCTTTGGATTCGAAGGCCAGCAACCTGTCAACCTTGTCAAAGAAGTACCGCCAAGATGCAAAGTACCTGAACATGCGCTCCACTTACGCCAAGCTGGCCGCCGTAGCAGTCTTCTCCGTCATGCTCATTGTGTATATCCGATTCTGGTGGTTGTGA
Full Trace Sequence: cgtctgtctcccccggtcaacatggtcctgctaacgatgatcgcccgagtggctgacgggctcccgctggctgcttccatgcaggaggacgaacagtcaggcagggacctgcagcagtaccagaaccaggccaagcagttgttccgcaagctgaatgaacagtctccaacgcggtgcaccctggaggcaggagccatgaccttccactatctgattgagaaaggtgtttgttatctggttctctgtgaagctgctttccccaagaagctggcctttgcttatctggaagatctgttttctgaatttgacgaacaacatgggaagaaagtgcccaccgtgtcacggccatactcctttatagagttcgataactacatccagaagacaaagaagtcatacatcgacagccgagccagaagaaatcttagttctgttaacactgagctgcaggatgtgcagagaatcatggttgctaatattgaagaagttttgcttcggggagaagcactttcagctttggattcgaaggccagcaacctgtcaaccttgtcaaagaagtaccgccaagatgcaaagtacctgaacatgcgctccacttacgccaagctggccgccgtagcagtcttctccgtcatgctcattgtgtatatccgattctggtggttgtgaagcgaggaagacggagataaaatactgtgaagatgagagagggttgggggagtgtttgccaaggtcttaaccctctcactgctagtggccatctctgcagtgatgcggttaatggattttgcacataacagtgtgcgtagagatcactgatgctctggcctcacagctggcttgtagggaacataaacattaaaagtagtgctccttttccaatggccagctaggagtaagaatgcacatggcttagttcctttatcttgtcatctctgcacagccaccctggactggttcctaggaaccctcccttgctatctgacagcgtattcttggttgctctcctatcccttttaggctactaatataataagcaggtttctactactccagaagaagccactttgctcccagtgtctgctccaaaggccttgtaggggataaacagatccatttcaatgggataacatcagaagaaacaagcttgcatactaggatattgcagctcaccaagaacacacaggatctggggaaaccaagtagttatataattatactgcaagttgccaattattaaagggattttacatgtaataaaactgacactgctgtttcatagcagggtatggggggggggaggtagaactttaaagacttgcccaagtatcgcactgagctgcattcagcaggaagaaaacagttgtctcagtctaataaatgatacatattatctaccattaaaaaaaaaaaaaaaaaa
Translation: MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQNQAKQLFRKLNEQSPTRCTLEAGAMTFHYLIEKGVCYLVLCEAAFPKKLAFAYLEDLFSEFDEQHGKKVPTVSRPYSFIEFDNYIQKTKKSYIDSRARRNLSSVNTELQDVQRIMVANIEEVLLRGEALSALDSKASNLSTLSKKYRQDAKYLNMRSTYAKLAAVAVFSVMLIVYIRFWWL
Donor tissue: tailbud