ORFeome > sf3b4 – XORFeome 2.0

sf3b4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis splicing factor 3b, subunit 4, 49kDa, mRNA (cDNA clone MGC:75907 IMAGE:5383583), complete cds
Gene Symbol: sf3b4
Gene ID: 394721
ORF gb_acc: MG132986
ORF ID: 10367

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061357

Library Location

Plate ID: GDExt11005
Well Location: A01

EST Sequences

Clone: MGC:75907 IMAGE:5383583
Trimmed Sequence: ATGGCGGCTGGGCCGATATCTGAACGGAACCAGGATGCCACAGTGTATGTCGGAGGCCTGGATGAAAAGGTGTCTGAGCCTCTTCTATGGGAGCTCTTCTTGCAAGCAGGGCCTGTAGTGAATACACACATGCCCAAAGACAGGGTCACGGGGCAGCATCAAGGTTATGGCTTTGTGGAATTTCTGAGTGAGGAGGATGCCGACTACGCCATAAAGATTATGAACATGATAAAGCTCTATGGGAAACCCATTAGAGTAAATAAAGCCTCGGCGCACAACAAAAACCTGGATGTCGGCGCCAACATCTTCATTGGAAACTTGGACCCAGAGATTGATGAGAAGTTGCTTTATGACACCTTCAGCGCTTTTGGTGTAATCTTGCAGACCCCCAAGATCATGAGAGACCCAGACACCGGCAACTCCAAAGGTTATGCCTTCATCAACTTTGCCAGTTTTGATGCTTCGGACGCAGCCATTGAGGCCATGAACGGACAGTACCTGTGCAACAGGCCCATCACCGTCTCCTATGCTTTCAAGAAGGACTCCAAAGGAGAGCGGCATGGGTCGGCCGCAGAGAGACTGCTGGCTGCCCAAAACCCACTTTCACAGGCTGACCGGCCTCACCAGCTTTTCGCCGATGCCCCTCCACCTCCGTCTGTACCAGCTGTCATTACATCATTAACAAGTGCAGTTGCTGCAGGCATGCCCACATTTCCTCCTGTCCCTCCACCTGGTGCAATGCCGCCGGGTATCCCACCCTCAATGCCGCCTCCTCCAATGTCTCCTGTCACAGGCGCCGGGCAAGCAGCTGCAGCTGCTCCTCAAGTCCCACTTCCTTTTCAGTCTGCAGCTATGCATCCAGGTATGCAGATGCAGATGCCTCACCCCTCTATCCCAGGAGCATCGCCGCTTGGAACACGTCCACCTGGAATGGGACCACCAGGACCCCCTCCTATGGGAATGCCACCAAGAGCGCCACCGTTTGGAGCCATGGGTCACCCAGGCATGCCTCCAGGTATGAGGCCACCACCCCTGATGCCACCATACAACGGGCCACCTCGACCCCCACCATATGGTTACCAACGTGCCCCAGTACCCTTACCCCGACCGGCCCCACGCCCACCAGCACCACCTCGACCTCCAATGAGGCTCCCTATGTCACAATGA
Full Trace Sequence: gaagcagcgaggtggctgagtggttggcggcgagaaaatggcggctgggccgatatctgaacggaaccaggatgccacagtgtatgtcggaggcctggatgaaaaggtgtctgagcctcttctatgggagctcttcttgcaagcagggcctgtagtgaatacacacatgcccaaagacagggtcacggggcagcatcaaggttatggctttgtggaatttctgagtgaggaggatgccgactacgccataaagattatgaacatgataaagctctatgggaaacccattagagtaaataaagcctcggcgcacaacaaaaacctggatgtcggcgccaacatcttcattggaaacttggacccagagattgatgagaagttgctttatgacaccttcagcgcttttggtgtaatcttgcagacccccaagatcatgagagacccagacaccggcaactccaaaggttatgccttcatcaactttgccagttttgatgcttcggacgcagccattgaggccatgaacggacagtacctgtgcaacaggcccatcaccgtctcctatgctttcaagaaggactccaaaggagagcggcatgggtcggccgcagagagactgctggctgcccaaaacccactttcacaggctgaccggcctcaccagcttttcgccgatgcccctccacctccgtctgtaccagctgtcattacatcattaacaagtgcagttgctgcaggcatgcccacatttcctcctgtccctccacctggtgcaatgccgccgggtatcccaccctcaatgccgcctcctccaatgtctcctgtcacaggcgccgggcaagcagctgcagctgctcctcaagtcccacttccttttcagtctgcagctatgcatccaggtatgcagatgcagatgcctcacccctctatcccaggagcatcgccgcttggaacacgtccacctggaatgggaccaccaggaccccctcctatgggaatgccaccaagagcgccaccgtttggagccatgggtcacccaggcatgcctccaggtatgaggccaccacccctgatgccaccatacaacgggccacctcgacccccaccatatggttaccaacgtgccccagtacccttaccccgaccggccccacgcccaccagcaccacctcgacctccaatgaggctccctatgtcacaatgaatagaagaaatggactccccttcagcctgtgtaacatgttatccctacagaccatcagaacttgtcagcatttaagcccagttcatttccatttcagatatagcggccccccatcagtttgttattaattcacatgtacaggtgtacagaattgtttttgtaacaaagccctctgggaatatccccataggctcctgttgtcattttacattccatggctggaataaatatcagtgcagtttttatgttattgccatgtaggtatgtgaattgcattgcttcaataaatggaaaactccatagacatttaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSVPAVITSLTSAVAAGMPTFPPVPPPGAMPPGIPPSMPPPPMSPVTGAGQAAAAAPQVPLPFQSAAMHPGMQMQMPHPSIPGASPLGTRPPGMGPPGPPPMGMPPRAPPFGAMGHPGMPPGMRPPPLMPPYNGPPRPPPYGYQRAPVPLPRPAPRPPAPPRPPMRLPMSQ
Donor tissue: neurula