ORFeome > slc25a1 – XORFeome 2.0

slc25a1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1, mRNA (cDNA clone MGC:76218 IMAGE:5336306), complete cds
Gene Symbol: slc25a1
Gene ID: 395026
ORF gb_acc: MG132810
ORF ID: 10155

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064874

Library Location

Plate ID: GDExt11002
Well Location: H01

EST Sequences

Clone: MGC:76218 IMAGE:5336306
Trimmed Sequence: ATGGGCTCCAAGAGCGGCTCCCCTTGCCTCCCCCGATCGCCTCTCCTTGCCCTCACGGGATCTCCTGTGGCAATGCCAGCTGGGTATCGGTCTCTGGCTGCCGCGGCTCCTGCAGGAGGTTCCAAGCTTACTCACCCGGGGAAAGCCATCCTGGCAGGTGGCATTGCCGGCGGGATAGAAATCTGCATCACATTCCCTACAGAATATGTCAAGACACAGCTACAGCTTGACGAGAAGGCGAATCCCCCACGGTATCGAGGCATATGGGACTGTGTGAGGCAAACGGTGGAGGGCCATGGAGTGAAAGGTCTGTATCGGGGTCTTAGTTCCTTGCTGTATGGATCCATCCCCAAAGCAGCTGTTAGGTTTGGAATGTTTGAGTTTCTAAGCAATCGGATGCGGGATGCTAATGGAAAGCTGGACAGTAAGCGCAGTTTGCTGTGTGGTCTGGGGGCAGGTGTGGCCGAAGCTGTAGTTGTGGTCTGTCCCATGGAAACCATTAAGGTGAAATTTATTCATGATCAGTGCTCCCCCAATCCTAAATACAGAGGTTTCTTCCATGGTGTACGAGAGATCATTAGAGTCCAAGGTATAAAGGGGACCTATCAGGGTTTGACAGCCACTGTGCTCAAGCAGGGATCCAACCAAGCTATTCGCTTTTTTGTTATGACATCTTTAAGGAATTGGTACAGAGGGGACGACCCTAACAAACCAATGAACCCATTAGTGACTGGCGCCTTTGGAGCCATTGCTGGTGCTGCTAGTGTGTTTGGCAACACCCCATTAGATGTAGTAAAGACCAGGATGCAGGGTCTGGAAGCCCACAAATACAAGAGCACTTGGGACTGTGCCTATAAAATCCTTAAATATGAAGGACCCAGAGCGTTCTATAAGGGTACAATACCCCGCCTTGGACGTGTCTGTCTAGATGTTGCCATAGTCTTCATCATTTATGATGAGGTAGTCAAAGTCCTGAACAAGGTGTGGAAGACGGACTGA
Full Trace Sequence: caacggaacccgagcggctctcggtctccacgttccagaggcagcagttccacgtcactgtgtccgggtagcggcgctgcgatccccactctgaccgacatcatgggctccaagagcggctccccttgcctcccccgatcgcctctccttgccctcacgggatctcctgtggcaatgccagctgggtatcggtctctggctgccgcggctcctgcaggaggttccaagcttactcacccggggaaagccatcctggcaggtggcattgccggcgggatagaaatctgcatcacattccctacagaatatgtcaagacacagctacagcttgacgagaaggcgaatcccccacggtatcgaggcatatgggactgtgtgaggcaaacggtggagggccatggagtgaaaggtctgtatcggggtcttagttccttgctgtatggatccatccccaaagcagctgttaggtttggaatgtttgagtttctaagcaatcggatgcgggatgctaatggaaagctggacagtaagcgcagtttgctgtgtggtctgggggcaggtgtggccgaagctgtagttgtggtctgtcccatggaaaccattaaggtgaaatttattcatgatcagtgctcccccaatcctaaatacagaggtttcttccatggtgtacgagagatcattagagtccaaggtataaaggggacctatcagggtttgacagccactgtgctcaagcagggatccaaccaagctattcgcttttttgttatgacatctttaaggaattggtacagaggggacgaccctaacaaaccaatgaacccattagtgactggcgcctttggagccattgctggtgctgctagtgtgtttggcaacaccccattagatgtagtaaagaccaggatgcagggtctggaagcccacaaatacaagagcacttgggactgtgcctataaaatccttaaatatgaaggacccagagcgttctataagggtacaataccccgccttggacgtgtctgtctagatgttgccatagtcttcatcatttatgatgaggtagtcaaagtcctgaacaaggtgtggaagacggactgagatgcgccattggtgatgcactaaacagacttggacaactgggagctgttccaggctctcttgggtgccaaaggttccagtcagacactgctatgaaccccttatccttccggtacctaactggttcaatccctcccagccctaagaacttatattccttaaacatttacatttacattcacacatttccactgcttgttacacagccaagcaactgcttcagcaaaatagaatgttgcgattttcctctgcagtgtgggagataactggttaacgtctggtgcactgcgtccttgcaccccggggtttcattttaaattccctttggtttttatggatttttattttaatttttttttttaatgtttataactttatatcatctcttaattcccccatgtaaataatcattaagatctttattaagcatttttttttaatgagacagggttgtttggtgacaaattgcaatattggcttagacagcatgttttgcttttttcagcatgaggtttacagctaaaccacagctcccttactgggagtgcagaggttaaaatgtttttcatgtaaacgtgaaggtaactggattggtgttactgcagtctttaaattagaggaacatactctgcctttaacttatccctgttgggaattctagactttatttcttatgtaccactccctggtggtatttctactgtgccaaactttgctttaagtacttcgttgttatgactccaaatctgtgccaaaatatcagcccaaagctcaaatttactattggagtctccagcgcatctgaacttccccctgcagggggcagaactgggtatctgttcataaacacttttaacattgttgtcttaaatatacaatattgccatttatttacagttcttattgtttatcactgatgtttttggagctctaattcaaattcatgaaggctttactatccccccccccccccctccccgataaaataaaactctctgaagttttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGSKSGSPCLPRSPLLALTGSPVAMPAGYRSLAAAAPAGGSKLTHPGKAILAGGIAGGIEICITFPTEYVKTQLQLDEKANPPRYRGIWDCVRQTVEGHGVKGLYRGLSSLLYGSIPKAAVRFGMFEFLSNRMRDANGKLDSKRSLLCGLGAGVAEAVVVVCPMETIKVKFIHDQCSPNPKYRGFFHGVREIIRVQGIKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDDPNKPMNPLVTGAFGAIAGAASVFGNTPLDVVKTRMQGLEAHKYKSTWDCAYKILKYEGPRAFYKGTIPRLGRVCLDVAIVFIIYDEVVKVLNKVWKTD
Donor tissue: tailbud