ORFeome > slc25a24 – XORFeome 2.0

slc25a24 – XORFeome 2.0

General Information

Species: Xenopus tropicalis solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, mRNA (cDNA clone MGC:79557 IMAGE:6978438), complete cds
Gene Symbol: slc25a24
Gene ID: 496457
ORF gb_acc: MG134297
ORF ID: 11969

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084172

Library Location

Plate ID: GDExt11019
Well Location: G01

EST Sequences

Clone: MGC:79557 IMAGE:6978438
Trimmed Sequence: ATGCTCGAGCAAGTACAGAAATTTCTGCTATCCAGAGCTGCTTGCGAAGGTCCTGATCCCCACACCAGATACGCTGAGCTCTTCCATAAACTGGATGTTAATAAAGATGGGAAGGTGGACATCGTGGAACTGCAGGAGGGCCTCAAAGCCATGGGAATGGCAGTTGGCAAAGGAGCAGAAGAGAAAATTGTAGCAGCAGGAGACACTAACAAGGATGGGCATCTGGACTTTGGGGAGTTCATTCGATATCTGGAAGAACATGAGAAGAAAATGAAAATAGCCTTTACGAGTCTGGACAAAAACAAGGACGGTAAGATTGAGTCCGCAGAGATAATGAACTCTCTCAAAACTCTGGGCATCAACATTTCTTTAGAACATGCTGAGAAAATCCTTAAGAGTATGGATGCCGATGGAACTCTCACAGTGGACTGGAATGAATGGAGGGACCACTTCTTGTTTAACCCAGCTGACAACATCCAACAAATTATTCGATACTGGAAGCACTCAACGGTGCTGGACATAGGAGATAGCCTCACTATCCCAGATGAGTTTACAGAAGAAGAAAAAAAGACTGGACAGTGGTGGAAGCAACTGTTGGCCGGTGGAATGGCTGGGGCTGTGTCTCGCACAGGAACTGCTCCTTTGGACCGTTTGAAAGTCATGATGCAGGTTCATGGATCCAAGGGAAATGCAAACATCATTACCGGCCTGAAACAGATGGTAAAAGAGGGAGGCATTCGATCCCTTTGGAGAGGAAATGGGGTTAATGTGATTAAGATTGCTCCTGAGACAGCAATGAAATTCTGGGCATATGAGCAGTATAAGAAACTGTTCACATCAGAGAGTGGCAAATTGGGAACTGCGGAGCGGTTTATAGCTGGATCTCTTGCTGGAGCAACAGCACAAACCTCAATCTACCCTATGGAGGTTCTAAAAACTCGTTTGGCTGTGGGGAAAACAGGGCAATACTCTGGAATGTTTGACTGTGCTAAGAAGATAATGCAGAGGGAAGGAGTAAGAGCATTTTACAAAGGATACATCCCCAACATCCTTGGAATCATTCCTTATGCAGGCATTGACCTTGCCATTTATGAGACACTCAAAACCTTTTGGCTGCAGAACTATGCAACAGACTCTGCCAATCCTGGGGTGCTGGTCTTGTTGGGATGTGGCACTGCGTCCAGTACATGTGGCCAGCTGGCCAGCTACCCTTTAGCTCTCATCAGGACGAGAATGCAAGCACAAGCATCTATTGAGGGTGCACCTCAGCTAAACATGGGAGGTCTCTTCAGAAAGATTGTTGCCAAAGAAGGATTTTTTGGACTGTATAGGGGCATTGCTCCTAATTTCCTAAAGGTGTTGCCTGCTGTCAGTATAAGCTATGTGGTGTATGAGAAAATGAAGATAAAACTGGGTATCTGA
Full Trace Sequence: cttcctatagccacaaccagtcctcctccttctctctgggcgctgtcctgtcacaaccttctgataagaacagacttccttacccgccctgaagccattcacagcagcaatgctcgagcaagtacagaaatttctgctatccagagctgcttgcgaaggtcctgatccccacaccagatacgctgagctcttccataaactggatgttaataaagatgggaaggtggacatcgtggaactgcaggagggcctcaaagccatgggaatggcagttggcaaaggagcagaagagaaaattgtagcagcaggagacactaacaaggatgggcatctggactttggggagttcattcgatatctggaagaacatgagaagaaaatgaaaatagcctttacgagtctggacaaaaacaaggacggtaagattgagtccgcagagataatgaactctctcaaaactctgggcatcaacatttctttagaacatgctgagaaaatccttaagagtatggatgccgatggaactctcacagtggactggaatgaatggagggaccacttcttgtttaacccagctgacaacatccaacaaattattcgatactggaagcactcaacggtgctggacataggagatagcctcactatcccagatgagtttacagaagaagaaaaaaagactggacagtggtggaagcaactgttggccggtggaatggctggggctgtgtctcgcacaggaactgctcctttggaccgtttgaaagtcatgatgcaggttcatggatccaagggaaatgcaaacatcattaccggcctgaaacagatggtaaaagagggaggcattcgatccctttggagaggaaatggggttaatgtgattaagattgctcctgagacagcaatgaaattctgggcatatgagcagtataagaaactgttcacatcagagagtggcaaattgggaactgcggagcggtttatagctggatctcttgctggagcaacagcacaaacctcaatctaccctatggaggttctaaaaactcgtttggctgtggggaaaacagggcaatactctggaatgtttgactgtgctaagaagataatgcagagggaaggagtaagagcattttacaaaggatacatccccaacatccttggaatcattccttatgcaggcattgaccttgccatttatgagacactcaaaaccttttggctgcagaactatgcaacagactctgccaatcctggggtgctggtcttgttgggatgtggcactgcgtccagtacatgtggccagctggccagctaccctttagctctcatcaggacgagaatgcaagcacaagcatctattgagggtgcacctcagctaaacatgggaggtctcttcagaaagattgttgccaaagaaggattttttggactgtataggggcattgctcctaatttcctaaaggtgttgcctgctgtcagtataagctatgtggtgtatgagaaaatgaagataaaactgggtatctgagaagtaaaagatatgactttctcactcaggaactcaagtgtttattctgtgtttaaacgagccattgtgggaggtttcttttataggggctggaaaactaaatcctgtccatcagtgaatcagatggttggctctgctatcaccagagtgataatggttaaaaccgaaaaacaaaaaaagattaaatctatcttttattattttgggggtgggaacatttaccattctagtctgttcatttttgttccaagagctttttataatgtccaaattgagctcaattccatacaatgttcatttggaaatcctaagtgaacgtgaaacaggttcatctttatgtatgcatcttttttaaacattttaattgtgaccataggggattgtttaacaaccaaaattaaatgttcagccaagtcttaaattggccttaaagttatgagaggagagcagcaatggagacctatagttatttctgtgaatgtttttatgtatgtaatgaacaatggctgctaaaaacaaatcaattcaaagggcttgtgatattcatatgcattaggcctcagaaaaggggtttgcttcatttgtatccaccattgtttagaactgatgctccatggcaactaacttgtaaactagtttaattctttatcgtccatttcagcctgaagttacactgtccatgatagagtgccttaccatgtatacaacaggtactttaatccctgtattgaacctacagagttatcattattttcatgtacccactcactgtcattgttttaatagaaagaaaggacagcagcacactcaccatacggtggacaccaccattcatctctcttctatgcaatttccctttgttgcgtagaacaaaatatccaagaaccatagactctgaatgagagtattttagtgtggttatggcatattactgtaaataatgttggacaagttctttaaaatggacagtatttttaacagttctattgcgtcctttccctgttgccagatagagttacatgaaaagcaaatccattctgactgacctgggttctgtttacaaaaaatatatatatacatatatatatatatatatgtgtgtgtctgccaaagatatcgctgtgcaataccataatggatttgtaacattttgttttgtttttatacagggctaagaatttataatgtaaataaattccttatgttcactaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLEQVQKFLLSRAACEGPDPHTRYAELFHKLDVNKDGKVDIVELQEGLKAMGMAVGKGAEEKIVAAGDTNKDGHLDFGEFIRYLEEHEKKMKIAFTSLDKNKDGKIESAEIMNSLKTLGINISLEHAEKILKSMDADGTLTVDWNEWRDHFLFNPADNIQQIIRYWKHSTVLDIGDSLTIPDEFTEEEKKTGQWWKQLLAGGMAGAVSRTGTAPLDRLKVMMQVHGSKGNANIITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAERFIAGSLAGATAQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGAPQLNMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI
Donor tissue: tailbud