ORFeome > slc34a2-prov – XORFeome 2.0

slc34a2-prov – XORFeome 2.0

General Information

Species: Xenopus tropicalis solute carrier family 34 (sodium phosphate), member 2, mRNA (cDNA clone MGC:76273 IMAGE:5379265), complete cds
Gene Symbol: slc34a2-prov
Gene ID: 394921
ORF gb_acc: MG132790
ORF ID: 10114

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064262

Library Location

Plate ID: GDExt11002
Well Location: D05

EST Sequences

Clone: MGC:76273 IMAGE:5379265
Trimmed Sequence: ATGGGGAAAGATAAGACCAAGAATCAGAAGAAGCTGAAGGTTGCAGCCAATCACAACGCAGAGGAAGAATTTAATGCTGTGCCGCACTCTTTCGTTTTCCAACGAGGGCAGATTGGAAAGAATGTGCAGCAGCTCATCGTGGATGTCCGGAGAGCCATGGAGCCCTTTACTGCCCGCTCTCTAAAGGTTCGGAAGAAGAACACACTGAAAGACTTTGTAGCAGTGGCGGGGCCCCTAGGTGTTACTCATTTCATGATCTTCACCAAAACCACAACCAATGTCAATTTCAAATTTGTTCGCTTGCCCAAAGGACCTACATTAAGCTTCAAAGTGAACCAGTACTCTCTTATGAAGGACGTGGTCTCCTCTCTGAAGAAGCACAGAATGCACGAGGAGCAGTTTACGCACCCACCCCTACTGGTGCTTAATAACTTTGGCAACCAAGGAATGCACGTCAAGTTGATGGCCACCATGTTCCAGAATATGTTCCCTTCCATTAATGTGCACAAGGTGAACTTAAACACCATCAGGAGGTGCATTCTCATTAACTACGATGATGAAACACAGCAACTGGACTTCAGGCATTACAGCCTGAAGGTGGTACCAGTTGGCATGAGTAAAGGAATGAAGAAACTCCTCCAAGAGAAATTTCCCAACATGAGCCGCTGGGAGGACATCAGTGAGCTCCTGGTAAAAGGAGCCAACCTGTCTGAAAGTGAAGCTGAGCAGGACGGGGACCACAACATAACGGAGCTGCCGCAGGCGTGCGCGGGACGCGGGAACATGAAGGCTCAGCAGAGCGCCGTAAGACTGACGGAGATTGGGCCCCGGATGACTTTACAGCTGGTGAAAATAGAAGAGGGTCTAAGTGACGGCAAAGTGTTATATCACGGCTTCATTCAGAAGACAGAAGAGGAGATCAAGGCCATGTTGGATAGCAGAGAGAAGAAACTCCAGCGGAAGAAAGAGAGGAAGAAGAAGCAAGAGGGAGATGTGGAACGCAAGAAGAACCTGAAGGAGGAGAACAAGAAGCGCAGCTTAGCCGGAATGAAGAGGAAGCGCGGGGACGGGGAGGCCAGTGACAGTGAAGTGGAGGATCCTGGTACTTTGGGAGATCAGGATCCAGCTGACCAATCAGAAGATGATGATGCTGAGTATTACAGACAGGAAGTTGGAGAGGAGCCAGATAAAGATCTCTTTCTCCACACCAAGAAAAGGTTCAGCCAGAAACCTGGGCCTCCCAGAAAGAAATTTAAAGGGTCTGGAAAAGAGAAGCCAAAGTCCGACACGCGTGGGGGGCACAACAGGCCTCACAGCGGCAAATCACCCATCCAGAAACGTGGAGCCAATGTGGGAGGGAAAGCCTTTAAATCTGCTCACAAACTGAAAGGCCAGAAATTCCAAGGAAAGGGAACTGAGCACAGACCCCAGCAAGGAGGCAAAAAGTTCCCCGGCAGTAAAAGGGGGTTCGGACCTAAGAGCCCCAAGACTGGCCATAAACCCAAAGGGCCGGGGCATAAACCCAAAGGGCCGGGGCATAAACCCAAAGGGCCGGGGCATAAACCCAAAGGGCCGGGGCATAAACCGGCAGACAAAAGAGGCAAACCCTTCAAGCAGAAGAGAAAGTGA
Full Trace Sequence: cacgtgtgtgccggagcagcacttctgccaacatggggaaagataagaccaagaatcagaagaagctgaaggttgcagccaatcacaacgcagaggaagaatttaatgctgtgccgcactctttcgttttccaacgagggcagattggaaagaatgtgcagcagctcatcgtggatgtccggagagccatggagccctttactgcccgctctctaaaggttcggaagaagaacacactgaaagactttgtagcagtggcggggcccctaggtgttactcatttcatgatcttcaccaaaaccacaaccaatgtcaatttcaaatttgttcgcttgcccaaaggacctacattaagcttcaaagtgaaccagtactctcttatgaaggacgtggtctcctctctgaagaagcacagaatgcacgaggagcagtttacgcacccacccctactggtgcttaataactttggcaaccaaggaatgcacgtcaagttgatggccaccatgttccagaatatgttcccttccattaatgtgcacaaggtgaacttaaacaccatcaggaggtgcattctcattaactacgatgatgaaacacagcaactggacttcaggcattacagcctgaaggtggtaccagttggcatgagtaaaggaatgaagaaactcctccaagagaaatttcccaacatgagccgctgggaggacatcagtgagctcctggtaaaaggagccaacctgtctgaaagtgaagctgagcaggacggggaccacaacataacggagctgccgcaggcgtgcgcgggacgcgggaacatgaaggctcagcagagcgccgtaagactgacggagattgggccccggatgactttacagctggtgaaaatagaagagggtctaagtgacggcaaagtgttatatcacggcttcattcagaagacagaagaggagatcaaggccatgttggatagcagagagaagaaactccagcggaagaaagagaggaagaagaagcaagagggagatgtggaacgcaagaagaacctgaaggaggagaacaagaagcgcagcttagccggaatgaagaggaagcgcggggacggggaggccagtgacagtgaagtggaggatcctggtactttgggagatcaggatccagctgaccaatcagaagatgatgatgctgagtattacagacaggaagttggagaggagccagataaagatctctttctccacaccaagaaaaggttcagccagaaacctgggcctcccagaaagaaatttaaagggtctggaaaagagaagccaaagtccgacacgcgtggggggcacaacaggcctcacagcggcaaatcacccatccagaaacgtggagccaatgtgggagggaaagcctttaaatctgctcacaaactgaaaggccagaaattccaaggaaagggaactgagcacagaccccagcaaggaggcaaaaagttccccggcagtaaaagggggttcggacctaagagccccaagactggccataaacccaaagggccggggcataaacccaaagggccggggcataaacccaaagggccggggcataaacccaaagggccggggcataaaccggcagacaaaagaggcaaacccttcaagcagaagagaaagtgacttgctgggaataatctgatggactccttgtaaataagagtgtaattatgtgcccctctccttgcattttgtcactgagctctgaaataaaactgccccgctggtattacatctcattgggtcggtactgactgctatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGKDKTKNQKKLKVAANHNAEEEFNAVPHSFVFQRGQIGKNVQQLIVDVRRAMEPFTARSLKVRKKNTLKDFVAVAGPLGVTHFMIFTKTTTNVNFKFVRLPKGPTLSFKVNQYSLMKDVVSSLKKHRMHEEQFTHPPLLVLNNFGNQGMHVKLMATMFQNMFPSINVHKVNLNTIRRCILINYDDETQQLDFRHYSLKVVPVGMSKGMKKLLQEKFPNMSRWEDISELLVKGANLSESEAEQDGDHNITELPQACAGRGNMKAQQSAVRLTEIGPRMTLQLVKIEEGLSDGKVLYHGFIQKTEEEIKAMLDSREKKLQRKKERKKKQEGDVERKKNLKEENKKRSLAGMKRKRGDGEASDSEVEDPGTLGDQDPADQSEDDDAEYYRQEVGEEPDKDLFLHTKKRFSQKPGPPRKKFKGSGKEKPKSDTRGGHNRPHSGKSPIQKRGANVGGKAFKSAHKLKGQKFQGKGTEHRPQQGGKKFPGSKRGFGPKSPKTGHKPKGPGHKPKGPGHKPKGPGHKPKGPGHKPADKRGKPFKQKRK
Donor tissue: tailbud