ORFeome > slc5a8 – XORFeome 2.0

slc5a8 – XORFeome 2.0

General Information

Species: Xenopus tropicalis solute carrier family 5 (iodide transporter), member 8, mRNA (cDNA clone MGC:69201 IMAGE:5307429), complete cds
Gene Symbol: slc5a8
Gene ID: 394505
ORF gb_acc:
ORF ID: 11932

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090570

Library Location

Plate ID: GDExt11018
Well Location: C12

EST Sequences

Clone: MGC:69201 IMAGE:5307429
Trimmed Sequence: ATGGTTACCCCGGGGAATATTGGTTCCTTCACAGTTTGGGACTATGTGGTGTTTGCCTTGATGCTGCTGATTTCAGCAGTGATTGGAATCTATTATGCTTTTGCTGGGGGTGGACAGAAGACCTCTAAAGATTTCCTGATGGGTGGGAGAAGCATGACTGCTGTGCCCGTGGCCCTATCCCTAACTGCCAGCTTTATGTCAGCAGTTACAGTGCTAGGCACCCCAGCAGAAGTGTACCGCTTTGGATCCATGTTCAGCATATTTGCCTTCACATATGCCATAGTGGTGGTTATCAGCTCAGAAGTCTTCCTGCCGGTGTTCTACAGACTGGGCATCACTAGCACTTATGAGTACCTAGAACTTCGCTTTAATAAGTTTGTCCGGCTCCTCGGCACCATACTTTTCATCATACAAACGGTCTTGTACACTGGAATTGTTATTTATGCCCCTGCTTTGGCTTTAAATCAAGTAACTGGGTTTGACCTGTGGGGTGCTGTTGTTGCCACCGGGGTGGTTTGTACCTTCTACTGTACAATGGGAGGCCTGAAAGCTGTGGTCTGGACGGACGTGTTCCAAGTTGGAATCATGGTGGCTGGCTTTTCTTCTGTAATCATAAGAGCAGTTGTGGTCCAGGGTGGCATTGGTCCTATTCTGAATGATTCTTACTATGGAGATAGATTGAACTTTTGGGATTTCACTCCTAACCCTCTGCAAAGACATTCCTTTTGGACAATTGTAGTTGGAGGAACATTTACCTGGACAGGAATCTATGGAGTAAACCAATCTCAAGTTCAGAGATACATTGCATGCAAAACCAGATTCCAAGCTAAGCTGTCTTTGTATATAAATCTTCTGGGACTTTGGGCAATTCTTGCTTGTGCTGTATTGAGTGGATTGGCCATGTATTCAATTTATAAAGACTGTGATCCCTGGACTGCCCAGTTTGTGTCTGCCCCAGACCAGCTGATGCCCTACCTGTCTTTGGATATTCTGCGGGATTACCCAGGGCTCCCAGGGCTCTTTGTTTCATGCGCTTACAGTGGGACATTAAGTACTGTCTCCTCTAGCATAAACGCTTTAGCTGCTGTAACAGTGGAAGATCTTATAAAGCCTTACTTCAGATCCCTCAGTGAAACAAAGATGTCTTGGATCTCCAAAGGAACAAGCCTTATATATGGGGCAATATGCATTGCAATGGCTGGTCTGGCATCTCTAATGGGTGGCTTGTTACAGGCAGCTCTGTCTATATTTGGCATGGTTGGGGGTCCTTTGCTGGGCCTGTTTGCCCTAGGCATCATCTTCCCATTTGTAAACTCACTAGGTGCTGTGATTGGTCTCCTGTCTGGATTCGCGATTTCCCTATGGGTTGGCATCGGCTCCCAGATTTATCCTCCCACTGCATCCAGTAGCTTACCCAAACCTCTGTCACTTGAGGGCTGCAATTTCACCAGTTTTGAAAGTAACTGGACTACCACAGTGATGCCAATGATGACAACCTTAATTCCTGAAGTCAGCAGCAGGCCAGAACTTGCGGATAGCTGGTACTCGCTATCATATCTGTATTTCAGTACTCTTGGGACAATAGTTGCAGTTGTAGTTGGTGTGATAGCCAGTCTGCTATCAGGAGGGTTAAAACAAAATGTAAACCGTGATTTCCTCTTAACCTCTCAAGACTTTTCCTACTTGAATGTTCTGTTCTCAAATTGCAAAAAGAAAGGGCAGGAAGAAAAAGTTGAAGTGTTGAACTGGAAGATGCGTAGTACAGATACTGATATGGATCAAGGCACAGATAACCCTGCATTCAATCATATGGAAATGAGCTCAACGGAAAAAAAAGAGAAAATGAATGGAATTATTGCATAG
Full Trace Sequence: cctgctccttagcttcttacaatcactgcacctgtagttacctcccctgggcatactttcttaattgaccttgtatttagctgtagttatctgccccctctaccctctcatttgttgataacttcccttggatattactgcctatatctgagcagatcccttttgggcactgttgctctaacacagaaacaatactcttttcactatggttaccccggggaatattggttccttcacagtttgggactatgtggtgtttgccttgatgctgctgatttcagcagtgattggaatctattatgcttttgctgggggtggacagaagacctctaaagatttcctgatgggtgggagaagcatgactgctgtgcccgtggccctatccctaactgccagctttatgtcagcagttacagtgctaggcaccccagcagaagtgtaccgctttggatccatgttcagcatatttgccttcacatatgccatagtggtggttatcagctcagaagtcttcctgccggtgttctacagactgggcatcactagcacttatgagtacctagaacttcgctttaataagtttgtccggctcctcggcaccatacttttcatcatacaaacggtcttgtacactggaattgttatttatgcccctgctttggctttaaatcaagtaactgggtttgacctgtggggtgctgttgttgccaccggggtggtttgtaccttctactgtacaatgggaggcctgaaagctgtggtctggacggacgtgttccaagttggaatcatggtggctggcttttcttctgtaatcataagagcagttgtggtccagggtggcattggtcctattctgaatgattcttactatggagatagattgaacttttgggatttcactcctaaccctctgcaaagacattccttttggacaattgtagttggaggaacatttacctggacaggaatctatggagtaaaccaatctcaagttcagagatacattgcatgcaaaaccagattccaagctaagctgtctttgtatataaatcttctgggactttgggcaattcttgcttgtgctgtattgagtggattggccatgtattcaatttataaagactgtgatccctggactgcccagtttgtgtctgccccagaccagctgatgccctacctgtctttggatattctgcgggattacccagggctcccagggctctttgtttcatgcgcttacagtgggacattaagtactgtctcctctagcataaacgctttagctgctgtaacagtggaagatcttataaagccttacttcagatccctcagtgaaacaaagatgtcttggatctccaaaggaacaagccttatatatggggcaatatgcattgcaatggctggtctggcatctctaatgggtggcttgttacaggcagctctgtctatatttggcatggttgggggtcctttgctgggcctgtttgccctaggcatcatcttcccatttgtaaactcactaggtgctgtgattggtctcctgtctggattcgcgatttccctatgggttggcatcggctcccagatttatcctcccactgcatccagtagcttacccaaacctctgtcacttgagggctgcaatttcaccagttttgaaagtaactggactaccacagtgatgccaatgatgacaaccttaattcctgaagtcagcagcaggccagaacttgcggatagctggtactcgctatcatatctgtatttcagtactcttgggacaatagttgcagttgtagttggtgtgatagccagtctgctatcaggagggttaaaacaaaatgtaaaccgtgatttcctcttaacctctcaagacttttcctacttgaatgttctgttctcaaattgcaaaaagaaagggcaggaagaaaaagttgaagtgttgaactggaagatgcgtagtacagatactgatatggatcaaggcacagataaccctgcattcaatcatatggaaatgagctcaacggaaaaaaaagagaaaatgaatggaattattgcatagtattggtcaatattctttactgttttagtagagaggaaacatatggggtggttatcatcatgtggacaagctggaattttgctgccaaatttaatattttctaaaggacagtcacgtgcattaaccttcccaaagggtttcatgaaaactgagaaaaaatgcttttacacctgttattcatttttagagattatattaaaggtttataagggtcagaactgcttaagtccgacaaaacaagctgtgcatggctatatttattattacactaaagaggacttaaatcttgctttattttgctccccctagctttctaaagtggatgtcccgccaattttaaataataattagagaccagtagaaaaaatatgtttatgtctctaacgagacatatgaacaaagaatagacagtagtcttagaaggcttgcattacgtgggccagtggctctgcacagatgtaaaaagttttatcaaccagcttttctttaagaatacagcccttctcttaatgaattacagtttccagcatgctttagagagggattttgcctctattaacttatagtatgttatagatggttacattatttattttttatgacccttcctattattgttatttgccttctcctattcatctgccattctccctaccctagggctgccctgttgctaggataattaggccctagcaactagaaatttcaagcctaaggggctgatttactaatccacgaatccgaatgagaaaaattcggattggaaaacgaacattttgcgactttttcgtatgttttgtgatttttttgtcgccgttatgactttcccgtaaattgtcgcgactttttcgtaaccggtatgacttgcgtaaattgtcgcgactttttcatagccataacaaatttcgtgaattgtcgcgactttttcattgccattatgcctttggagaattgtcgcgactttttcattgccattatgcctttggagaattgtcgcaactttttcattgccattatgcctttggagaattgtcgcgactttttcattgccatttcgcgaattgtcgctactttcgtattgagagctcgaaaaagtcgtgacaatttgcgaaaaaatcgcaaagtaccgatcattacgaaaaaaccgcattcggacgctttttggacgttcgtggattagtaaatgtgcccctaagagttgcacatcaaaaatgaagtgaccaaaaaccacaaaaataataaatagagtagttgcaaattgtcatagaatacaaatctctacttcaaactaaaggttcattttttggacaaatgctatatgatctataaaaccaaaaagctaaggaaacaaaactgagaaaacaactcttgtatgaaatgatccaaccaatggcagatttagatgagggaactccagatgatcttctgtgcccctgtgcatgctgtcatggaaaaggaagtaacaataggacagatagatggtggagcagggatacagcctggggccaaagcaaaaatattggatgtctctgaaacctacatatttaattgtctaaataatttaacacaaatattattagctagatgaccttgcacccccttgatgagctctggttaggccttacctttaatgtatataccattacacatccatccttagtctctactgagctatacatgttttatttgctctttccagactaagtgcatcagccatctatcttataatctcccaaagcagaacattctcatgtactgatcatcgtactggccagctgctgtataatatctatatgcatatactgtgtgtattgttgtatttttttgttattgtttattaaaattcattttattatttgcaaaaaaaaaaaaaaaaaaaaaaaagggcggcctgatgtaagaggtggaaaccgggtgttgcggagacacaagaggccggagagggtgactggagcctagaggggcacaaggcagggagctgtaggcgcagcacagccgtgttacaccgacaccatgtccggagacgagatgattttcgacccaactatgaccagaaagaaaaagaagaagaagaagcctttcatgctggatgaagatggggctgagccacaggcagaagagacgcaggtaccggagactaaagaagtggaaccagaaccaccagaagataaggattttgatgtcgatgatgaggcctttaaaaagaaagtcgatgcccctgatgacctggatgatttgaatttcttgaaccagaagaagaaaaagaagaaaacaaaaaagtttgacttggatgaagcagaggaaggggttaagaatcttaaaattgagggggatattcaggaggcatctgaatcccaggaggatgatttggatttcatgctgagcaagaaaaagaaaaagaaaaatgtgaaattcccagaggaggacgataccctggatagagatgaagccttcgaagaagaagacaataagaaagatgatggaatctcgttcagctcccagctgggtccggcctgggccggcacagaaagggactatacatacgacgagctgttaaacagagtgtttaatatcatgcgagagaagaatcccgacatggtggctggggagaagaggaagtttgtcatgaagcctcctcaggtcgtccgagtagggacaaagaaaacatcatttgtcaactttaccgatatctgcaaactgttacatcgtcagccaaaacacttgctggccttcttgttagctgaattgggtacaagtggctctatagatggtaacaaccagttagtcatcaaaggcagattccagcagaagcaaatagagaacgttctaagaagatatatcaaggaatatgtgacttgtcacacctgccgatcgccagacaccatcttgcagaaggacacccgattatatttcctgcagtgcgaaacctgccactcgcggtgttccgtggccagcatcaaaaccggattccaggccgtcacgggcaagagagcacagctccgtgccaaagccaactaactggcttccaaaccatttgggattttgccagcctggtgcgaggatatattgcagggacttgctgacagggggcgcagtaccctggcattataaggaatgctgtgagaagaggcctaaaacacattggctaatttttttttgttttttttaaatctttgcccgcgcaaagagattctaaagcagacaatggagccgattattccatatactcgcattgctctcggaaaacaatttttccagctgcctgaggggaagtgggaaggtagtgtatgcatttttaaccaaacctctgtaaaatgcaaaaatacattaaagttattacatgattcacagaacaaaaaaaaaaaaaaa
Translation: MVTPGNIGSFTVWDYVVFALMLLISAVIGIYYAFAGGGQKTSKDFLMGGRSMTAVPVALSLTASFMSAVTVLGTPAEVYRFGSMFSIFAFTYAIVVVISSEVFLPVFYRLGITSTYEYLELRFNKFVRLLGTILFIIQTVLYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTMGGLKAVVWTDVFQVGIMVAGFSSVIIRAVVVQGGIGPILNDSYYGDRLNFWDFTPNPLQRHSFWTIVVGGTFTWTGIYGVNQSQVQRYIACKTRFQAKLSLYINLLGLWAILACAVLSGLAMYSIYKDCDPWTAQFVSAPDQLMPYLSLDILRDYPGLPGLFVSCAYSGTLSTVSSSINALAAVTVEDLIKPYFRSLSETKMSWISKGTSLIYGAICIAMAGLASLMGGLLQAALSIFGMVGGPLLGLFALGIIFPFVNSLGAVIGLLSGFAISLWVGIGSQIYPPTASSSLPKPLSLEGCNFTSFESNWTTTVMPMMTTLIPEVSSRPELADSWYSLSYLYFSTLGTIVAVVVGVIASLLSGGLKQNVNRDFLLTSQDFSYLNVLFSNCKKKGQEEKVEVLNWKMRSTDTDMDQGTDNPAFNHMEMSSTEKKEKMNGIIA
Donor tissue: gastrula