ORFeome > snai1 – XORFeome 2.0

snai1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis snail homolog 1, mRNA (cDNA clone MGC:76142 IMAGE:5335209), complete cds
Gene Symbol: snai1
Gene ID: 394880
ORF gb_acc: MG132726
ORF ID: 10023

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064223

Library Location

Plate ID: GDExt11001
Well Location: C03

EST Sequences

Clone: MGC:76142 IMAGE:5335209
Trimmed Sequence: ATGCCGCGGTCATTCCTGGTCAAGAAACATTTCTCTGCCAGCAAGAAACCCAACTACAGCGAGCTGGAGAGCCAGACAGTGTATATATCACCGTTCATCTATGACAAGTACCCACTTCCTGTGATCCCCCAGCCAGAGATTTTAACCACAGGAGCTTACTACACACCTCTTGTCTGGGACACTAGTTTACTCACAACATTTTTCACCTCTGAGCCTGACTACAAAAAGTCTCCCATCAGCCCTTCCAGCAGCGACGATTCCTCCAAGCCCTTAGACCTTACGTCTTTCTCCAGTGAAGATGACGAAGGGGGCAAGACTTCAGACCCTCCCAGCCCCGCATCGTCCGCCACAGAAGCGGAGAAATTTCAATGCAATCAGTGCAGCAAGTCTTACTCCACCTTTGCCGGACTTTCCAAGCACAAACAGTTGCACTGTGATTCCCAGGCGAGGAAGTCGTTCAGTTGCAAATACTGCGAGAAGGAGTACGTCAGTTTGGGGGCCCTAAAAATGCACATCAGGAGCCACACGCTGCCCTGCGTCTGCAAAATCTGCGGCAAAGCCTTCTCCAGACCTTGGTTATTACAGGGACACATTAGAACACACACAGGAGAGAAGCCATTTTCCTGTACGCACTGCAACCGTGCCTTCGCCGACCGCTCCAATCTCCGAGCCCACCTGCAGACCCATTCCGACGTCAAAAAGTACCAGTGCAAAAACTGCTCTCGGACTTTCTCCAGAATGTCCCTCCTTCACAAGCACGAGGAAACAGGGTGCACGGGAGCCCACTAA
Full Trace Sequence: cgctttcagccctatgcgactgcctctctgcgactgcgaacccaggaatcccctcatcggctgctaaaccccctcaccggctcagcaacatgccgcggtcattcctggtcaagaaacatttctctgccagcaagaaacccaactacagcgagctggagagccagacagtgtatatatcaccgttcatctatgacaagtacccacttcctgtgatcccccagccagagattttaaccacaggagcttactacacacctcttgtctgggacactagtttactcacaacatttttcacctctgagcctgactacaaaaagtctcccatcagcccttccagcagcgacgattcctccaagcccttagaccttacgtctttctccagtgaagatgacgaagggggcaagacttcagaccctcccagccccgcatcgtccgccacagaagcggagaaatttcaatgcaatcagtgcagcaagtcttactccacctttgccggactttccaagcacaaacagttgcactgtgattcccaggcgaggaagtcgttcagttgcaaatactgcgagaaggagtacgtcagtttgggggccctaaaaatgcacatcaggagccacacgctgccctgcgtctgcaaaatctgcggcaaagccttctccagaccttggttattacagggacacattagaacacacacaggagagaagccattttcctgtacgcactgcaaccgtgccttcgccgaccgctccaatctccgagcccacctgcagacccattccgacgtcaaaaagtaccagtgcaaaaactgctctcggactttctccagaatgtccctccttcacaagcacgaggaaacagggtgcacgggagcccactaaaatcaaagactataagcacaatggacttctttaaattcctgtatattttttggcaggatatatataaatataatatttttctttaaatgatgccattgctaaatttgtttagcaagctcacatgcaatcacttcgtttgggggggggaccctcaaaccttatgacacttatacggacccttattgtctatgatgcaaccgtagaatgccttattgcagtatcacagagagcctgccacctatccctctttgccacgggcacatctgggatttatatgccatatatctgggcagagggggtgttttattgttgggtgggaaaagactgaaatctgtttttatgaaggagcaatggaaagtgttacatatatatgtataagtaaaaggtgaatggcactcttgcttccaaaaaaagatgcccttgggcacccaaaaagatgccccggggcaaggtaagttagtatatagcacataatggacaatgctcaagctttcaatacactttgcatagtccattatacgctggtcttagggacgggggcttaatctatgcaaaaattgctgttcccccacagcattctgagcacccttcaccccccaccaatcacggcccaatggtggtcataaagagtcagcgcttcacaccacaatactgtttacagagcagcaatgcctaatcgggcacctgttagtgcctttcaagggagcagaaaggcagcagttggcacagagaacaatgggcggttataacttaagccaacccaagacaggtggacgagacataacttaaaaaagggggaaaaaaagactatttatggcctctgacaggtgccaagcggatgcatcgttttcttatttttttgttttttttattaaatattgttttacgtaacccttcctgagaatgtttacatttcaatggtacactggtatttatatattttttataaaggtgccacattttgtactgaggaatctgtgttttttatagctttacacactttattgatattcaataaaatgttttttttaatttataaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPRSFLVKKHFSASKKPNYSELESQTVYISPFIYDKYPLPVIPQPEILTTGAYYTPLVWDTSLLTTFFTSEPDYKKSPISPSSSDDSSKPLDLTSFSSEDDEGGKTSDPPSPASSATEAEKFQCNQCSKSYSTFAGLSKHKQLHCDSQARKSFSCKYCEKEYVSLGALKMHIRSHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCTHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSRTFSRMSLLHKHEETGCTGAH
Donor tissue: tailbud